CAZyme Information: EAW23715.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW23715.1
• CAZy Family: GT2
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		45631.06	6.5000

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027686:143666-145358(+)

Full Sequence      

MRAIAFLLFFTLLFTASGTILENGQARLNPYPGQAEVITLDKKTWRDYKPSAKEISYKGR
WDDKHISWLLDSSLHSLVKRLGGQDWQFSNVTANATYQFIGPTTTGLNLTNAGDAKSFEL
RGRHLQTGPTDTFPGSVYSKSLLTISTIQLAGVSVAADAKISRIAEYPKMVEIIGDSLSS
GDYATYEGLSSWAYDFAAGLGNVEYSITAYPGICLHDQNCWGNPRGQAYQWYRTSDTSWR
AHEIYGDNPPKWNFAAQRPADLVVINIGTNDNNPTNNVSSTDYYNDYITLVGNIHKIWPK
ADIVLMSLWGGFGASGDTYVQGPIWVDEIKRVYQHYEKQGFIHYFDTTGILQHNDIAPQW
HPTDFGHLKIAAHLMQWVKLKFGWEFGATGPEVHHGTLYWNDQANY

Enzyme Prediction     

No EC number prediction in EAW23715.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	172	377	4.8e-24	0.9808612440191388

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	6.25e-55	170	379	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	2.11e-16	171	376	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	8.88e-15	173	367	1	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238865	sialate_O-acetylesterase_like1	3.09e-06	250	376	53	185	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238863	SGNH_hydrolase_peri1	5.98e-05	254	307	51	103	SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17295.1|CE0	6.03e-187	17	406	15	400
QMW34907.1|CE0	2.48e-159	14	406	12	398
QMW46983.1|CE0	2.48e-159	14	406	12	398
QRD91240.1|CE0	2.48e-159	14	406	12	398
EAA62480.1|CE0	3.58e-156	17	406	16	307

PDB Hits     

EAW23715.1 has no PDB hit.

Swiss-Prot Hits     

EAW23715.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000295	0.999657	CS pos: 18-19. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in EAW23715.1.