CAZyme Information: EAW23241.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW23241.1
• CAZy Family: GH78
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
590		67511.45	6.4640

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027688:3479139-3480972(+)

Full Sequence      

MRVLFSTLFGIGIILVASQPVLTNFHTIELLIYENIKHHGAWSSQAKSSKTLADAVANYR
KRYNQHPPPGFDKWYEYATSRSSVVIDDFDQIHMDLLPFRALSPARLRDLTRDLATNPFN
DIGAISIRNGTPRVQEGIKPTHAWMVLGAAKMIENFAQYLPDMDLAFNLNDEPRVAVPWE
EASRLGTEAKSHGPAPDNSVLTVWSADRGMQWAPIEPADQTTETVFTDSSMQPIFDRYIR
QLCPPSTKARTKRIWDRRHMCLDCVRPHSMGQFPLDANSMSDICHQPDLAWLHGFFLSPA
SFKVSQVLTPVFSQSKVSGFNDILFPSPWNYVDKIKYEPSDEYPDQEYEEKENTLFWIGS
TSEGVSRSGEWKGMPRQRFAHLINNNTLSHVSVLLPVEGTDSYRYEVLDGSAPTNLLGLN
TTVHILNPVRCGSDCEAQKEELGAASSVDFQSHWKYRYLFDLDGAGFSGRFLPFLQSHSL
PFKTGLFRQWLDRRVTPWLHYVPIDVRLHGVWSTLAYFSKLDVPVTEDPDGQPKDIIQRH
DARGKYIAEEGRKWAEKALRKEDMEIYFFRLLLEWGRLTDDNRDMLGFKI

Enzyme Prediction     

No EC number prediction in EAW23241.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	287	579	9.5e-76	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.91e-13	310	578	32	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.37e-06	439	578	199	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD56220.1|GT90	0.0	1	588	286	874
UDD56219.1|GT90	0.0	1	588	403	991
QMW40301.1|GT90	0.0	1	588	403	991
QRD82703.1|GT90	0.0	1	588	403	991
QMW28231.1|GT90	0.0	1	588	403	991

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	2.26e-09	436	582	215	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	8.21e-31	42	584	165	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|A0NDG6|RUMI_ANOGA	1.04e-08	445	578	268	385	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	1.35e-08	436	582	243	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	4.33e-08	436	579	259	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	7.64e-08	445	579	271	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001566	0.998408	CS pos: 18-19. Pr: 0.9384

TMHMM  Annotations     

There is no transmembrane helices in EAW23241.1.