CAZyme Information: EAW23213.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW23213.1
• CAZy Family: GH78
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591	DS027688|CGC30	68289.66	6.4198

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027688:3400942-3402717(+)

Full Sequence      

MRLQRIVFLLGVVVLAGLSVVFLRRSHHDSDLPLNQSPPAIPHSPSVHISSNAQQQKHEP
ENSATTPFPRDRHPIATLVGNAEQEFEKLHSRQSKTLTDAVNEYRRRYHMHPPPHFDKWF
QFAQSRGVQLIDEYDTIYHSLLPFWAIEPKVIRERVREALGYDNAVIGVLIRKGKVTLVE
GGGDALKWQRDATVGMMSDFVEFLPDMDLVFNTHDEPRVVIPSDDLRRMVSIAKDSVLPR
SFQNQSPKNAWSPRPKDLNKGDRIDEVRTTRFNRYAHQPTWTDSRASCPVDSPARSLNED
APDNVGVYERGDPGFIYNTTAFSDICNTPSLRRTYGFFDRPNAFDVVHDLFPIFSQSKIS
SFQDILYPSPWYWANVVPYAEENDYPWDQKQEKMFWRGSTTGGFSRAGGWRRQHRQIFVG
NINSLDNVQVLAKTTDGQWQTKEVSRADYRDLFDVKFTFIGQCDPNDCDAQREFFEVVDA
VGQQDAWAYKYLVDIDGNAFSGRYYAFLHSNSLVCKVAIFREWHDEWIKPWVHYVPLSLA
GDEYVETMRYFVTEDEGKNTAAKIAGKGRDWALKALRNDDMEVWFFRLLLE

Enzyme Prediction     

No EC number prediction in EAW23213.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	328	591	5.6e-80	0.964

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	4.42e-18	348	591	28	248	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.32e-06	352	591	108	318	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR83603.1|GT90	1.42e-308	1	591	1	584
QMW37147.1|GT90	6.32e-308	1	591	1	593
QMW25089.1|GT90	6.32e-308	1	591	1	593
UCK57446.1|GT90	1.65e-307	1	591	11	603
BAE54850.1|GT90	5.37e-306	1	591	1	593

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	5.00e-10	352	589	154	372	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	2.14e-07	329	591	95	337	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.44e-48	62	591	140	651	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q8T045|RUMI_DROME	2.66e-09	352	589	166	384	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q29AU6|RUMI_DROPS	4.44e-08	352	589	164	382	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	1.30e-07	329	591	123	365	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	2.36e-07	352	589	164	382	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.969775	0.030254

TMHMM  Annotations     

Start	End
7	24