CAZyme Information: EAW21307.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW21307.1
• CAZy Family: GH47
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488	DS027690|CGC18	55825.09	5.0845

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027690:863883-865396(-)

Full Sequence      

MDLQSVQDLKGVLRSDFFHGYATAAAQVEGAWNKDGKGQSIWDTFAHTPGKVKDGSTADD
AVRSYDLYKEDVALMKSYGVNAYRFSLSWSRIIPLGGCDDPVNEKGIEYYSNLVDELLRN
DITPFVTLFHWDTPQALEDRYGGMLNQEKFVPDFVNYARVCFERLGDRVKHWITFNEPGV
YTLAGYAAGVHAPGRSSFRDRNEEGDSSTEPFIVAHTELVAHGHVSRLYKQEFQPHQQGT
IGITLHGNWSEPWDEADLLDQEAAERAREFEIAWFADPLYKTGDYPASMRAQLGDRLPKF
TPEESKLVLGSSEFYGMNSYTSFFVKHKTTPADINDHKGNVEIHDFNKQGVPRGEESDTE
WLRAAPWGFRKLLNWIWSRYQMPIYVTENGTTAKGETAPSPGVLNDQFRIRFFEGYVGWA
LARAVKEDGIDIRSYFAWTFTDNWEWAAGYTDRFGCTFIDFDSPEKTRYPKQSAYYLDKL
FKHLIKDS

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	13	482	9.9e-156	0.9790209790209791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	5.13e-163	9	486	1	449	Glycosyl hydrolase family 1.
225343	BglB	6.93e-133	16	485	7	450	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	8.54e-116	16	476	31	475	beta-glucosidase
215455	PLN02849	9.78e-116	14	482	27	481	beta-glucosidase
215539	PLN02998	1.16e-104	1	482	16	486	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP91982.1|GH1	0.0	1	488	1	488
QQK46886.1|GH1	0.0	1	488	1	488
BCS22190.1|GH1	3.57e-315	1	485	3	487
QGA20266.1|GH1	3.25e-300	5	485	5	489
ATZ52175.1|GH1	8.48e-286	4	485	5	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	4.82e-179	13	486	26	497	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	3.57e-178	12	485	2	463	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	7.18e-178	12	485	2	463	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	1.38e-177	12	485	21	482	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	1.72e-170	12	485	8	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	3.23e-171	13	488	11	478	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	3.68e-161	13	487	6	462	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q8L7J2|BGL06_ORYSJ	2.28e-140	10	482	47	520	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	1.37e-137	16	477	36	498	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1
sp|Q9SPP9|RG1_RAUSE	3.04e-137	15	481	24	511	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EAW21307.1.