CAZyme Information: EAW20870.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW20870.1
• CAZy Family: GH43
• CAZyme Description: mannosyltransferase (PIG-M), putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	DS027692|CGC4	46289.22	10.0206

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027692:586092-587488(-)

Full Sequence      

MTSFFNSPPKVIGASIALRAVLLVYGAWQDAHSPIKYTDIDYLVFTDAARYVSRGASPYA
RDTYRYTPLLAWFLLPTTWDNIPGFFSFGKALFALADVVAGWLIASVLVSAYGMNQSRAL
KYASVWLLNPMVANISTRGSSEGLLGVLVVGLLWAVLSRRVSLAGVILGLGVHFKIYPFI
YGPAVVWWLDAERDGSGSLRGTATATARARAAREKDKAQDILSKAVDFLTPARIHLTLVA
LATFSALNVSMYILYGLPFAHNTYLHHLTRIDHRHNFSPYSTLLYLSAAGGARTAFESLA
FIPQLLLSVVVIPLVLGKKSLAGTMLAQTFAFVTFNKYFLWYLIFLPFYLPSSSLMKNPR
KGVLVGLLWVVAQALWLQQGYNLEFLGLSSFVPGLFLASLFFFAVNVWILGIIVEDVGGS
A

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	135	413	2e-86	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	3.50e-80	1	414	1	415	GPI mannosyltransferase
252941	Mannosyl_trans	1.04e-61	135	414	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65877.1|GT50	1.66e-215	1	417	1	410
BAE66105.1|GT50	4.11e-215	1	417	26	435
QRD92382.1|GT50	2.73e-214	1	417	1	410
QMW36573.1|GT50	3.53e-214	1	417	8	417
QMW48628.1|GT50	3.53e-214	1	417	8	417

PDB Hits     

EAW20870.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WAH2|GPI14_ASPFU	1.53e-276	1	421	1	425	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	2.95e-216	1	417	1	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	2.06e-204	1	419	1	430	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	8.02e-159	1	418	19	486	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	1.26e-154	15	416	17	407	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999462	0.000563

TMHMM  Annotations     

Start	End
91	113
166	188
234	256
295	317
327	349
362	377
392	414