CAZyme Information: EAW20653.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW20653.1
• CAZy Family: GH37
• CAZyme Description: glycosyl hydrolase family 76 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283		31451.37	4.5839

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027693:704215-705130(+)

Full Sequence      

MQVARWDTTDCDGGMRWQIPLYLPGYTMKNAISNGGLFELSARLARFTMNNTYAQWAEKI
WDWSASTPLLQTNHWYIADSTSIEAKCKDAGNTQWSYNYGTYLSEASFMYNYTNGNEQWL
ERVNGLLNSLLGTFCPDDKGGNILSEVACEPIMTCDCNQIGFKGYTAMWLAHTAILVPST
ATRIYPVLQGSALAISKQCSKQPDNTCGIRWWQSTWDGFTPGLESQMAALGGITANLMYF
KSTAPKTIDTNPDGKEHQIIATHEEETILDTLLPIDAGDRAGA

Enzyme Prediction     

No EC number prediction in EAW20653.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	3	244	7.3e-63	0.6033519553072626

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.50e-109	1	230	123	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65549.1|GH76	4.66e-140	1	283	109	390
QMW48345.1|GH76	2.15e-139	1	283	155	436
QRD92720.1|GH76	2.15e-139	1	283	155	436
QMW36289.1|GH76	2.15e-139	1	283	155	436
UDD65548.1|GH76	2.15e-139	1	283	155	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	3.89e-47	11	280	176	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P6I3|YHG7_SCHPO	1.52e-63	3	283	146	422	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	1.39e-59	4	283	154	432	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	6.58e-58	2	238	153	385	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q6FLP9|DCW1_CANGA	3.29e-55	5	283	155	426	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	2.69e-54	5	283	158	429	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999424	0.000625

TMHMM  Annotations     

There is no transmembrane helices in EAW20653.1.