CAZyme Information: EAW20634.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW20634.1
• CAZy Family: GH36
• CAZyme Description: glycosyl hydrolase family 88, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		42225.30	5.7749

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027693:654743-655849(+)

Full Sequence      

MASNRPSQTEVHQTVKQLINNLVNIKDATGKFLLRLQDGRVIDTKSWHGWEWTHGIGLYG
IWKYYEMTGDESLLRIIEDWFAARFAEGGTTKNINTMAVFLTLAYVYEKTGNVTYLPWLD
AWAEWAMYELPRTRYGGMQHATYLTENYQQLWDDTLMMTVLPLAKIGKLLNRPEYIAEAK
RQFLVHIKYLFDTQTGLWFHGWTFEEGGHNFARARWARGNSWVTIVIPEIIELLDLEPTD
PIRVHLIDTLEAQCEALQRLQESETGFWHTLLDHPDSYIEASATAGFAYGILKAVRKRYI
GAQYRPVAEKAILAVMSAVDEHGELQNTSFGTGMGDCLQFYKDIPLTAMPYGQAMAIMAL
GEYLRTCL

Enzyme Prediction     

No EC number prediction in EAW20634.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	44	365	6.2e-111	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	3.13e-110	15	368	1	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	3.89e-102	24	366	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBO93662.1|GH105	6.18e-241	1	365	1	364
CAP80991.1|GH105	6.18e-241	1	365	1	364
QMW46699.1|GH105	2.70e-237	3	365	2	363
QMW34630.1|GH105	2.70e-237	3	365	2	363
QRD93550.1|GH105	2.70e-237	3	365	2	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	8.43e-174	7	365	4	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	4.71e-168	7	365	22	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.81e-167	7	365	23	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3K11_A	4.01e-23	151	365	199	412	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	6.46e-52	50	366	29	338	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	4.26e-12	152	325	201	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EAW20634.1.