CAZyme Information: EAW20625.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW20625.1
• CAZy Family: GH36
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
984	DS027693|CGC3	108209.27	4.3548

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027693:617643-620793(+)

Full Sequence      

MNRFAVLAMVMAFQVIHQANAKAVFAHFMVTNSENYTASDWQSDIGLAQDAHIDAFALNM
AWEDKTNDASVEMAFTAANAKGFKLFFSFDYAGNGPWDQDVVIRPGNAADWVTIKAKTNC
FFMPDWSSVGAKPAVGLANGVADGLFSWSAWPWGNQGMDTYTDASYIQYLDGKPYMMAIS
PWFYTNLPGYNKNWLWNGGSLWFDRWQELFGLDPMPEFVEIISWNDYGESHYIGPIRENA
LAALDIGKAPYNYVSGYPHDAWRDMLPFLIDLYKTGSASMDNDIATFWYSPNPLDYCSAG
GTTLNTASQLQIEFDPKDKLEARIWVMALFSDGNAAVYVNGHAVEWDSMPQTDVKGDGDI
DAGIWFGSVAAPPGMVTVDLFVRDSSTSFLKTIDITTSCDGGFNNFNAWVGSVRGGWYGP
SSTSVDLKDQVCVKGKGAYDFNPLCTFTCSYGYCPVGACTCEQMGVALTKPNATGTTGYP
AEGKDANYKGLCSFACNYGYCPSGTCDTIPCRCQQSRTSCRQPALLALETAQSSDCVRPL
VQPPAQSESAGMAAPGQPKKFDNLCDFTCSRGYCPPGTCISEAEQRITEAEQEITEAIAT
SGYNISDFADFNLTILGTALTGEDGCTTLQKKQIRSGWVESWKIMNYIYKVAKAGIDFNE
AAAVEYLGPPSMNQDQWSNYKAIYLNLATIQPGWKILDPFDWFAWKIAVRCDDPGLQCSC
GRDVNTIAYTVQKDPKHQVAAINFCPQYFSLQTLKDAMYWADTTHTPGEYADLNNYYNNQ
ALVWIHELLHIDWVSMASSSGNIHHVSDIKVGYEEGNKGVMRYYTAYGPRMCKALARLGW
ATGKWTIQNADSLTLYAFAKYVQNALGNIYPHLPLAPPAPKSATIPFEIDDLFTLYNNGT
GERVLNTTLDNKLEWSLSQGVCAAADDEDGDEAASAVMTTMTTWPVETDYPSDYLSSWSS
WAGLTPTTTTTTTAAAATATAFGL

Enzyme Prediction     

EC	3.2.1.59:2	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	106	381	2.7e-85	0.6853333333333333
CBM24	431	506	2e-28	0.9868421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	4.26e-141	24	387	1	369	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	2.38e-112	18	276	1	283	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
211414	GH99_GH71_like	2.36e-33	24	270	1	283	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
199914	M35_deuterolysin_like	1.85e-31	625	857	1	166	Peptidase M35 domain of deuterolysins and related proteins. This family M35 Zn2+-metallopeptidase extracellular domain is found in fungal deutrolysins (acid metalloproteinase, neutral proteinase II), including some well-characterized metallopeptidase domains in Aspergillus oryzae (NpII), Aspergillus fumigatus (MEP20), Penicillium roqueforti (protease II) and Emericella nidulans (PepJ peptidase). The neutral proteinase II from Aspergillus oryzae (NpII) unfolds reversibly upon incubation at higher temperatures, and loss in activity is mainly due to autoproteolysis. MEP20 is encoded by the mepB gene, which appears to be associated with the cytoplasmic degradation of small peptides. PepJ peptidase is a thermostable enzyme released under carbon starvation. Most members of this family contain a unique zinc-binding motif (the aspzincin motif), defined by the HExxH + D motif where an aspartic acid is the third zinc ligand and is found in a GTXDXXYG or similar motif C-terminal to the His zinc ligands. The aspzincin motif is poorly conserved in one subgroup, that includes Asp f2, a major allergen from Aspergillus fumigatus. This subgroup in addition lacks the key conserved Tyr residue which acts as a proton donor during catalysis, and no protease activity has been detected to date for Asp f2.
211416	GH99_GH71_like_3	7.54e-05	134	244	201	318	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP83026.1|CBM24|GH71	2.17e-268	1	556	1	598
BCS05636.1|CBM24|GH71	3.86e-152	29	486	1	475
UPK95345.1|CBM24|GH71	1.01e-150	7	579	4	583
QKD62247.1|CBM24|GH71	1.41e-149	7	579	4	583
QMW33048.1|CBM24|GH71	4.55e-146	22	488	79	566

PDB Hits     

EAW20625.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6GX22|MU71A_PENRW	1.76e-43	18	416	32	433	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1
sp|O13716|AGN1_SCHPO	6.10e-39	6	293	4	322	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|O94510|AGN2_SCHPO	9.37e-24	22	285	11	309	Ascus wall endo-1,3-alpha-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000295	0.999678	CS pos: 21-22. Pr: 0.9736

TMHMM  Annotations     

There is no transmembrane helices in EAW20625.1.