CAZyme Information: EAW20373.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW20373.1
• CAZy Family: GH32
• CAZyme Description: pectinesterase family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416		44850.08	6.2691

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027694:1816584-1817879(-)

Full Sequence      

MRPSSALLALGLLPEALGKGAHPAETYKSCQRITPDPLQGCPHGTLFVSQTDHRAHFKSI
QAAIHSLPNDTSSHVILIGAGTYVEQLNVTRSGPLTLLGQSNRPWQRESYGDIDTNTPVQ
NDVQIYWNAANHNAAFPDNVYIGVLTIGPTYNATITGAGPTGYPVPADTPFGCSDFRACN
IDFRNEYVPYSDGPAHAVGLGYANAGFYSCGLYSYQDTLYVGKLANAYFYDNVIAGQTDF
LYGFGTAFIEKTTLSLRGCGGGITAWKGTNTTFENKYGVYIADSQVIAANASIVNDIKGR
CSLGRPWNNLHRSVFIDTYFDSSILPAGYTVGKGAPDNNFNSETLMAVYGVYGPGYNQAA
EKNGNVTRILDRKEVAPYARPVDVFMTPDGHQPNIAWLDPIAASTGGHRPVLDGTM

Enzyme Prediction     

No EC number prediction in EAW20373.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	48	378	9.8e-51	0.9618055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	6.79e-21	57	378	23	280	putative pectinesterase
215357	PLN02665	5.92e-19	51	378	74	348	pectinesterase family protein
215367	PLN02682	1.63e-18	42	359	67	338	pectinesterase family protein
395871	Pectinesterase	4.95e-18	57	378	12	289	Pectinesterase.
215535	PLN02990	3.67e-17	39	359	254	529	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL02030.1|CE8	9.62e-190	23	399	26	401
QKD51850.1|CE8	4.08e-177	5	399	8	402
QGI78782.1|CE8	5.79e-177	5	399	8	402
CCT65443.1|CE8	5.79e-177	5	399	8	402
QGI61595.1|CE8	5.79e-177	5	399	8	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NSP_A	6.39e-11	57	355	18	310	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1GQ8_A	4.25e-10	44	367	6	280	Pectin methylesterase from Carrot [Daucus carota]
3UW0_A	9.50e-09	48	324	35	300	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1QJV_A	3.66e-08	57	355	18	310	Chain A, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]
2NTB_A	3.66e-08	57	355	18	310	Crystal structure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTB_B Crystal structure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTP_A Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTP_B Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTQ_A Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937],2NTQ_B Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBT4|PMEA_NEOFI	5.73e-17	8	335	6	277	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.59e-15	8	330	6	271	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	1.59e-15	8	330	6	271	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|Q2UBD9|PMEA_ASPOR	4.26e-14	7	326	5	262	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	5.73e-14	57	326	44	262	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000354	0.999617	CS pos: 18-19. Pr: 0.9770

TMHMM  Annotations     

There is no transmembrane helices in EAW20373.1.