CAZyme Information: EAW20325.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW20325.1
• CAZy Family: GH31
• CAZyme Description: extracellular exo-polygalacturonase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	DS027694|CGC5	42278.14	6.0088

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027694:1704321-1705585(+)

Full Sequence      

MLYYRNLALLSLLSLSSAAPSQVERSPDAVFKPRAVCTPTAGGSSSIDDVPAIRKAISSC
GNGGTIVFPAGSTYYLNSVLDLAGCSNCDIQVEGLLMFSGSTEYWGGKTAMININKINAL
KLRSLTGSGVIDGNGQNAYDLFASNSDYERPTLLYITGGSNIEVSGLRQRNPPNVFNSVK
GDAKDVTFTNLRMDATSRSDNPPKNTDGFDIGSSTHVTISSVSVSNDDDCVALKPGCNYV
TVENVTCTGSHGISVGSLGKSSADTVQNVYAHRITMIDSTKAAGIKTYPSGNGHGLSTVK
NVTFSDFNVRGCDYAFQIQSCYGESASYCASHPGNAILQDIIVKGFSGTTSGKDDWVVAD
LNCGARGTCDVSMSDFSVKAPSGKATVLCANTPSSLGVTCTSGASG

Enzyme Prediction     

EC	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	55	393	5.9e-68	0.9723076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.99e-43	60	394	1	317	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	1.72e-28	41	391	54	388	polygalacturonase
178580	PLN03003	1.43e-24	41	387	31	367	Probable polygalacturonase At3g15720
177865	PLN02218	1.44e-24	41	391	75	419	polygalacturonase ADPG
215120	PLN02188	7.00e-20	41	391	44	389	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAL85450.1|GH28|3.2.1.-	1.05e-259	1	406	4	409
ASO96840.1|GH28	2.29e-237	1	406	1	406
QMW43960.1|GH28	1.41e-217	1	406	1	406
QRD90994.1|GH28	1.41e-217	1	406	1	406
QMW31926.1|GH28	1.41e-217	1	406	1	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	6.88e-210	19	406	1	388	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
6KVH_A	1.54e-31	27	400	2	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
1NHC_A	1.83e-31	37	394	3	332	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
6KVE_A	2.12e-31	27	400	2	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	2.44e-30	66	400	26	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBT5|XGHA_NEOFI	1.55e-297	1	406	1	406	Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xghA PE=3 SV=1
sp|Q4WBT4|XGHA_ASPFU	1.66e-260	1	406	1	406	Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xghA PE=3 SV=2
sp|B0Y9F8|XGHA_ASPFC	6.77e-260	1	406	1	406	Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xghA PE=3 SV=2
sp|B8NPS8|XGHA_ASPFN	2.51e-218	1	406	1	406	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xghA PE=3 SV=1
sp|Q2UBD8|XGHA_ASPOR	4.14e-217	1	406	1	406	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xghA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000339	0.999634	CS pos: 25-26. Pr: 0.5071

TMHMM  Annotations     

There is no transmembrane helices in EAW20325.1.