CAZyme Information: EAW20324.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW20324.1
• CAZy Family: GH31
• CAZyme Description: pectinesterase family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324		34873.06	7.0339

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027694:1702542-1703633(-)

Full Sequence      

MHLPSLVLGLLGLGLTASASPIEERSNRSKAPDGCLTVGSSGKYSTIGAALDALGDSKSD
ACIFIGAGTYKEQITIDYKGKLTMYGETTDTSSYKKNQVTITHTISSPQAGTLDKSATVN
VRSDGFKMYNINVINGYGKGSQAVALVANADKLGFYGCSFVGYQDTLYAKAGRQYYSNCY
IEGATDYIFGNASAWFGECDIMSVGPGYITAMSRTTADQTTWYAIDNCNIYGKPGVDLTA
KVYLGRPWRVLARVIYQNSQLSNIINPKGWTTMAEGATPLYYEYNNKGAGADTSKREYES
SISGAVSMNTVLGSGWNSWIDTTY

Enzyme Prediction     

EC	3.1.1.11:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	40	298	1.1e-85	0.8993055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	4.06e-66	31	296	5	271	Pectinesterase.
215357	PLN02665	1.17e-51	41	316	77	359	pectinesterase family protein
215170	PLN02301	7.42e-51	19	296	229	507	pectinesterase/pectinesterase inhibitor
215179	PLN02314	1.76e-49	19	296	263	545	pectinesterase
178372	PLN02773	2.91e-49	31	296	10	275	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EHA20167.1|CE8	2.44e-166	1	324	1	327
CAK47976.1|CE8	2.44e-166	1	324	1	327
BCS09280.1|CE8	1.41e-165	5	324	4	327
BCR96791.1|CE8	1.41e-165	5	324	4	327
AXH37591.1|CE8	1.15e-164	5	324	4	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	3.96e-164	27	324	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	5.62e-164	27	324	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	5.63e-38	32	296	7	278	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	4.04e-37	42	296	13	274	Chain A, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	1.07e-18	44	313	18	335	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBT4|PMEA_NEOFI	2.94e-240	1	324	1	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	2.51e-216	1	324	1	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	2.51e-216	1	324	1	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|A2QK82|PMEA_ASPNC	4.34e-167	1	324	1	327	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	3.29e-159	8	324	7	325	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000234	0.999739	CS pos: 25-26. Pr: 0.9236

TMHMM  Annotations     

There is no transmembrane helices in EAW20324.1.