CAZyme Information: EAW20055.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW20055.1
• CAZy Family: GH3
• CAZyme Description: beta-N-acetylglucosaminidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
931		101529.32	7.1421

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027694:931950-935175(-)

Full Sequence      

MAPKEDMLPPGWEDLDRQMGQLFMMGFDGTSVNPQIRSLIENYHLGSVLLTAKNLKSAEE
ATRLVLELQTIARDAGHPVPLLIALDQENGGVNSLYDEIYIRQFPSAMGIAATGSKSLAH
DVAYATAQELKAVGVNWILGPVLDVLTNVRTQPLGVRTTGDDPQEVSQYGVEFMKGYKKA
GLVTCGKHFPSYGNLEFLGSQTDVPIITESLEQLSLTALVPFRNAIVHGLDSMMVGGVSM
SSAGVNVMHACLSEQVVDDLLRKDLKFNGVVVSECLEMEALTHNIGVGGGTVMAKNAGCD
IILLCRSFPVQQEAINGLKLGVENGIIGRARIEQSLRRVLKMKAKCTSWDQALNPPGLPS
LMQMQPSHTSLSKRAYNNSISVVRDKQNLLPLSNIIEPNEELLLLTPLVKPLPASAVSRS
VTEHMNVSIDPIASDRTASVLSGESVFKELGRSLSRQRSGRVLHTSYTANGVRPIHENLI
DRASAVIVVTADANRNLYQHGFTKHVSLICRSQFTPSGEPREKPMIVIAASSPYDFAMDT
SIGTYVCTYDFTETALEALVKVLYGELTPKGSLPGSISRSQKLHQARQHWLVENWNEERD
AQSLDTLLDAVRADCAQGQRSELLGVTSSSFLLRREEIDEAHFVVRNSSTQALYGFCSTY
FFRSTGTGVIGSLIVDPARRKLSIGNSLHNRAIRTLLQRKGMRRFQLGSRLPGIYLGIPS
SNPVERKRLRQWFANLGWNTALSRPVCSVVLRNLPTWTPPDGLVQGLKNADVSYDLVHGW
DYAEPILDHIKTNSRQGLIDIYKIALGGAPNCGIIRATRPSDGAILGTVVIYNGRSPLAE
HMPVLKATQPSSGGISSPVISPSVGEYATVMQGLILLGIKQIRRQGAEAVVIDCVDGDSN
FDCLSGMGFSMLHSFEEVNCDAATWTMMPTT

Enzyme Prediction     

No EC number prediction in EAW20055.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	303	3.4e-53	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.44e-71	15	401	3	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.75e-62	15	340	2	314	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	9.47e-34	19	338	1	308	beta-hexosaminidase; Provisional
185053	PRK15098	1.64e-08	15	343	47	353	beta-glucosidase BglX.
178629	PLN03080	5.35e-08	104	574	114	585	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15461.1|GH3	0.0	1	928	1	928
BCS03847.1|GH3	0.0	19	928	1	910
BAE65506.1|GH3	0.0	1	928	30	958
QMW48185.1|GH3	0.0	1	928	1	929
QMW36125.1|GH3	0.0	1	928	1	929

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	1.84e-88	13	738	7	679	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	6.32e-60	15	578	13	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.09e-44	15	577	44	617	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.41e-44	15	577	18	591	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.11e-44	15	577	48	621	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	5.60e-44	15	577	44	617	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	3.53e-34	16	393	29	399	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	9.17e-32	30	578	49	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	1.26e-27	24	332	7	308	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|Q6LJ30|NAGZ_PHOPR	2.64e-27	19	318	1	287	Beta-hexosaminidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EAW20055.1.