CAZyme Information: EAW19834.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW19834.1
• CAZy Family: GH25
• CAZyme Description: Melibiase subfamily, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757	DS027694|CGC3	84926.94	5.6619

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027694:246508-248781(-)

Full Sequence      

MMLIGAILAGICPANIYPSLSTIPQVKEVLETPVTRLVDPEMPSQTITLESQALRVKVLI
DKDGAAFLQGVLPLPDTSPTPASKNFSDSYAPLVEVRLAGEGTERNKSSKSLVGSYVGSR
LQYQSHEIERGADTQTLHVRLQDGISGALVTSHLTVYEGFPVLRATASIQNGGDKDLVVT
QLTSLVLGGLSTNSKRWWHEYRLSVPNNSWFREAQWIEHDLPSLGVDDCGVYGRPDEHWG
SLTHYSVSNRGTFSTEGHLPMGLLKHVSGKDTWLWQVENNGSWRWEIGDWKDSIYLAAGG
PVETEHDWRERLAPGQEFTTVPVALCHVQDDYEEAFAAMTRYRRQIRRKHRDHDGLPIIF
NDYMNCLMGDPTEEKILALVDPVVKAGAGYFVIDAGWYADDSGWWDDVGLWEPSQKRFPS
GFKALLSQIRNKGLIPGLWIEPEVIGVRSAVAKQLPNEAFFQRDGHRVVEKNRYQLDYRH
AAVREHMSAVIHRLVTEYGVGYFKFDYNIDVTQGTDISCSSPGSGQLEHNRAYLHWVNEL
HDRYHDLVIENCSSGAQRMDYAMLAVHALQSSSDQQDPERYPAIASALPTAVTPEQGAIW
AYPQPAWDDEFNAMTVVNSLLGRVHLSGRLDLLRPEQFDLIKEGMDVYRAIRADLPTATA
FWPLGLPQWHDDWFSLGMVVTKREGNGRQCYYLSIWRRGGPESIDLPVKALCGRDVSTEI
LYPTSFPATIEWLSNKGLLKVTIPSEMGARLIKLTAE

Enzyme Prediction     

No EC number prediction in EAW19834.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	117	673	1.5e-95	0.7892441860465116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269892	GH36	2.00e-87	356	650	2	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
307952	Melibiase	4.47e-32	342	593	27	295	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
225882	GalA	4.60e-24	307	652	242	586	Alpha-galactosidase [Carbohydrate transport and metabolism].
269893	GH27	1.59e-09	360	434	5	80	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
407116	Glyco_hydro_36N	5.35e-08	119	187	72	154	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE64621.1|GH36	0.0	45	756	5	716
QMW46905.1|GH36	0.0	45	756	62	773
QRD91154.1|GH36	0.0	45	756	62	773
QMW34832.1|GH36	0.0	45	756	62	773
UDD63863.1|GH36	0.0	45	756	5	716

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	4.87e-24	121	560	106	538	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	6.43e-24	121	560	106	538	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
4FNQ_A	7.31e-22	76	577	70	551	Crystal structure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	2.22e-21	78	577	59	551	Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNT_A	8.93e-21	78	564	59	538	Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G1UB44|MELA_LACAC	2.50e-23	121	560	106	538	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
sp|Q9ALJ4|AGAA_GEOSE	1.14e-20	78	577	59	551	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
sp|P43467|AGAL1_PEDPE	6.11e-20	128	603	126	569	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
sp|P43469|AGAL2_PEDPE	1.41e-16	128	578	122	546	Alpha-galactosidase 2 OS=Pediococcus pentosaceus OX=1255 GN=agaS PE=3 SV=1
sp|Q5ARP5|AGALG_EMENI	2.25e-15	119	577	99	550	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.525339	0.474668

TMHMM  Annotations     

There is no transmembrane helices in EAW19834.1.