CAZyme Information: EAW19816.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW19816.1
• CAZy Family: GH25
• CAZyme Description: fungal chitosanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242		25329.81	3.9747

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027694:197458-198282(-)

Full Sequence      

MRYLATATVLAGVGLASAYTVPANLQQIYNKHKTGTCQNKLQDGFSDGISGSSSFAYCGD
IEGAIFLHSSANGGQYDNMDIDCDGANNSAGDCANDPSGQSMTAFMDTVKQYGISDLDAN
IHPYVVFGNSGSSPTFDPQQYGMEPLSVMAVVCNNQLFYGVWGDTNGGTSTGEASISLAK
LCFPNDGITGDNGHGEEDVLYIGFMGQDAVPGASAAWTARDTETFEESIKALGDRLVAKL
SA

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	14	238	7.9e-83	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	4.29e-103	79	239	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJG44374.1|GH75	2.20e-162	1	242	1	242
SMY28686.1|GH75	1.22e-112	1	241	1	237
SMR63344.1|GH75	1.22e-112	1	241	1	237
AAS77607.1|GH75	1.56e-112	10	242	9	235
QYT03532.1|GH75	1.56e-112	10	242	9	235

PDB Hits     

EAW19816.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	6.84e-173	1	242	1	242	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	1.13e-111	16	242	15	241	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	1.05e-103	16	242	15	245	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	1.05e-103	16	242	15	245	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q8NK76|CSNB_ASPOZ	1.26e-103	16	242	15	240	Endo-chitosanase B OS=Aspergillus oryzae OX=5062 GN=csnB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000290	0.999696	CS pos: 18-19. Pr: 0.9775

TMHMM  Annotations     

There is no transmembrane helices in EAW19816.1.