CAZyme Information: EAW19807.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW19807.1
• CAZy Family: GH20
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559	DS027694|CGC13	62217.27	5.3043

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027694:178490-180270(+)

Full Sequence      

MLFSSLVSLALAAGVHAKGPFLQKIDDATHIIGNDLWNVTIGQQYGVKLYYKGKDLVGDA
VGHYVSYNGAQSDLNWTSAEIYRKGKTKGQDFLDIQFTAKEGDFHWVIFEDLVGAYQYFV
NHALPTLGEFRTLWRLDNTSFPNGRTNIKDGALPTLAEIASGTKVQDETWQLADGSYITK
YDWTAWIRDQDYYGVYGDEFGSWYINPGKDYYNGNHLKQELMVHRESSTGDAVQLNMIHG
THFMVSSNDVFPDGKVWGPWLWYLNDGSKTDAAARAADEFKAWPYKWFEDEAYQSRGSVS
GRLVLSDGRPAAGASVFLGDNHPNKTALDMGTTYYYTGQTDDKGWFKFEDVRTGDYGLQA
WSNGGQLADVATSFLQNDVTVRESHTAKLGTLKWEVPSRTRIFQVGDFDRKSLGFQYGGA
PYEHALVAQCPANLTYTVGQSRTADWCFGQAALGTWSIRFEAAKSSAALLTVSLAGYSSG
TTSTILLNGDAASPIGNLTTLPNDPCLYRSATTAGEWRLFQFEIPQGKLQPGWNSIDFAV
GKASRWHGFMWDSIILEYL

Enzyme Prediction     

No EC number prediction in EAW19807.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	31	542	3.1e-250	0.9903660886319846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199907	RGL4_N	8.94e-60	26	273	6	265	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405384	CBM-like	3.88e-46	401	556	1	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.
199905	RGL4_C	3.83e-30	403	557	1	161	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199904	RGL4_M	3.71e-17	295	392	1	92	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
404503	CarboxypepD_reg	1.77e-08	298	389	1	77	Carboxypeptidase regulatory-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO65538.1|PL4_5	5.62e-284	17	558	25	574
BCS19874.1|PL4_5	1.09e-259	17	558	26	572
UQC83548.1|PL4_5	3.97e-249	6	554	130	703
CBY02118.1|PL4_5	4.65e-244	3	557	13	569
CAE6996798.1|PL4_5	4.34e-243	3	557	6	563

PDB Hits     

EAW19807.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8RJP2|RHIE_DICD3	2.17e-61	6	536	14	557	Rhamnogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=rhiE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999701	CS pos: 17-18. Pr: 0.9770

TMHMM  Annotations     

There is no transmembrane helices in EAW19807.1.