CAZyme Information: EAW19698.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW19698.1
• CAZy Family: GH18
• CAZyme Description: BNR/Asp-box repeat protein, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	DS027695|CGC1	40330.17	6.3620

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027695:938095-939189(-)

Full Sequence      

MPGHLGQKILKTFGLDDQRGPHPFQPQNDARLPGNRLINNDERLLSSDPSGTYPRLAKLS
DGSILSAFTRFAGQTRILTVAKSTDGGRTFHDFGEVTRSQGDCDNLFLLEVAPSIVLGAF
RNHDLGPNGPTHFRITVCRSTDGGRSWQYAAQAVEKSPPNGIWEPFMRLGRQGEVQLFYS
QEYAHDNQCTMLVRSFDQGSSWSPPECLEGINDRIRDGMTGIASTVDNGREALVMVFETT
RYGTFNLEALLSYDDGRTWGWRHEVYVPPRGHNAGAPQIASFADGSLAVIFMTDEDERDV
QWTNNACIKMVFAGPPQDGRISWTQPTVICPHRSHWPGVLALDHHTLLAVYECGGPKGKT
VTLQ

Enzyme Prediction     

No EC number prediction in EAW19698.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	50	306	5.6e-69	0.8957654723127035

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	3.77e-11	114	358	26	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	9.65e-10	68	296	103	327	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	5.51e-05	59	209	153	300	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	0.002	46	152	194	298	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA62412.1|GH93	2.97e-201	1	364	1	367
QMW42642.1|GH93	2.79e-195	1	363	1	378
QMW30589.1|GH93	2.79e-195	1	363	1	378
QRD89469.1|GH93	2.79e-195	1	363	1	378
BAE60328.1|GH93	2.79e-195	1	363	1	378

PDB Hits     

EAW19698.1 has no PDB hit.

Swiss-Prot Hits     

EAW19698.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000005

TMHMM  Annotations     

There is no transmembrane helices in EAW19698.1.