CAZyme Information: EAW19665.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW19665.1
• CAZy Family: GH18
• CAZyme Description: glycosyl hydrolase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
739		78744.66	5.6931

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027695:865260-867574(-)

Full Sequence      

MQNLFLSLLAAAVTVHAYGSGGSNWDQAYSRAKDALQKLSQTEKVGLVTGVKWMGGPCVG
NTYKPESIDYPSLCLQDSPLGIRFANPVTAFPAGINAGATWDTQLLYARGAAMGAEAKGL
GVHVQLGPVAGPLGKNPNGGRNWEGFSVDPYLSGVAMEKTIRGMQDSGVQACAKHWLGNE
QEHYRDTISSNIGDRAAHELYVWPFMDAVKADVASVMCSYNKVNGTWACESDAINNKLMK
EELGFPGYIMSDWNAQHSTVNSAVSGLDMTMPGSDFSNPPGSIFWGSNLEAAVADGSVPQ
SRLDDMVTRILAAWYLVGQDKGYPPVAFSSWNGGKANVDVTADHGTVARAVARDSIVLLK
NDQRTLPLRKPKSLAIVGLDAIVNPAGPNACSDRGCNNGTLAMGWGSGTAEFPYLVGPLD
AIQKRAAADGTKIVPSTTDDPTAGASAAAAAETAIVFINSDSGEGYITVEGNLGDRNNLD
PWHNGNELVKAVAAASKNVIVVVHSVGPIILETILAQPSVKAIVWAGLPGQESGNALVDV
IYGDTAPSGKLPYTIAKQAADYGASWINAETDDFTEGLYIDYRHFDAKGIAPRYEFGYGL
SYTTFKYSGLWVNVYTSAGAANGKVVPGGPADLFEVVGQVSVFVRNNGRVAGAEVAQLYI
GLPDSAPATPPKQLRGFQKMMLQPGQMGRATFELTRRDLSYWDVQQQKWVVPSGTFKVYV
GSSSRDIREEGSFRVRRGW

Enzyme Prediction     

EC	3.2.1.21:16	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	67	272	1.1e-60	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.59e-60	75	733	97	762	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.58e-57	356	582	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	1.39e-54	83	402	75	385	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	8.29e-43	75	721	94	769	Probable beta-xylosidase; Provisional
405066	Fn3-like	1.63e-32	654	724	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIM56897.1|GH3|3.2.1.21	0.0	1	739	1	739
AMR94085.1|GH3|3.2.1.21	0.0	2	735	4	737
CAP86346.1|GH3	0.0	1	735	1	735
QQK47671.1|GH3	0.0	1	735	21	755
EAU32193.1|GH3|3.2.1.21	0.0	7	735	7	736

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JXG_A	0.0	21	734	2	711	Crystasl Structure of Beta-glucosidase D2-BGL from Chaetomella Raphigera [Chaetomella raphigera]
3ZYZ_A	1.21e-312	22	735	6	712	Chain A, Beta-d-glucoside Glucohydrolase [Trichoderma reesei],3ZZ1_A Chain A, BETA-D-GLUCOSIDE GLUCOHYDROLASE [Trichoderma reesei]
4I8D_A	1.26e-312	22	735	7	713	Chain A, Beta-D-glucoside glucohydrolase [Trichoderma reesei],4I8D_B Chain B, Beta-D-glucoside glucohydrolase [Trichoderma reesei]
5FJJ_A	2.27e-225	18	732	15	837	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5JU6_A	3.33e-223	18	727	33	845	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGT3|BGLL_ASPFU	0.0	1	739	1	739	Probable beta-glucosidase L OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglL PE=3 SV=1
sp|Q0CEF3|BGLL_ASPTN	0.0	7	735	7	736	Probable beta-glucosidase L OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglL PE=3 SV=1
sp|B0YB65|BGLL_ASPFC	0.0	1	739	1	739	Probable beta-glucosidase L OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglL PE=3 SV=1
sp|A1DCV5|BGLL_NEOFI	0.0	1	739	1	739	Probable beta-glucosidase L OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglL PE=3 SV=1
sp|Q5B9F2|BGLL_EMENI	0.0	25	735	26	737	Probable beta-glucosidase L OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglL PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999722	CS pos: 17-18. Pr: 0.9794

TMHMM  Annotations     

There is no transmembrane helices in EAW19665.1.