CAZyme Information: EAW19158.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW19158.1
• CAZy Family: GH16
• CAZyme Description: aminonitrophenyl propanediol resistance protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
496	DS027696|CGC31	56035.48	6.0672

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027696:5599890-5601602(-)

Full Sequence      

MNRHHAFANGYSAYPRGQSRAFSISPHRFQPRPQSALRRRRLLIQRLCLIGGISLLILVL
IFPSWRAAILPTLSLGLMHSSEDLQLQTVRYYDLSKVQGTAQGWEKGERVLMLTPLRDAS
SHLPMFFSHLRNLTYPHNLIDLAFLVSDSKDDTLGMLTRMLEEVQNDPDPKMTFGEISVI
QKDFGQKVQQDVESRHGFAAQAGRRKLMAQARNWLLSATLRPTHSWVYWRDADVETAPRT
ILEDLMRHDKDVIVPNVWRPLPDWLGGEQPYDLNSWQESETALALAETLDEDAVIVEGYA
EYATWRPHLAYLRDPFGDPDMEMELDGVGGVSILAKAKVFRSGVHFPAFSFEKHAETEAF
GKMAKRMGFSVIGLPHYTIWHLYEPSVDDLRHMEEMEQERKAREREEKEQAERAERMKAL
FVDPGPQWDIDKAFVQDSIQTEKEEAGQTKADGVTGAAEVKDVQGSASHPVAASPKPSVN
AAPVAQGSPGEAERSV

Enzyme Prediction     

No EC number prediction in EAW19158.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	87	350	1.5e-125	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	2.93e-163	88	350	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89585.1|GT62	3.28e-264	1	445	1	445
UDD59518.1|GT62	3.96e-264	1	445	1	445
CAK42575.1|GT62	2.05e-261	1	472	1	472
BCS13588.1|GT62	2.47e-261	1	472	1	470
BCS01889.1|GT62	2.47e-261	1	472	1	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	2.06e-61	89	386	6	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	8.13e-159	88	393	61	366	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	9.83e-153	22	395	14	385	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|Q00314|VAN1_CANAX	1.15e-122	80	393	67	430	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P23642|VAN1_YEAST	3.74e-122	88	393	171	523	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|P53697|MNN9_CANAL	9.73e-68	82	384	66	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999864	0.000157

TMHMM  Annotations     

Start	End
47	69