CAZyme Information: EAW19039.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW19039.1
• CAZy Family: GH16
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
444	DS027696|CGC33	51024.65	6.7209

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027696:5272382-5273785(+)

Full Sequence      

MRWTQGQPPWTRFLVPGAAISMIVVTFLILGSQYSSDYAKYALKNSLKTTPPSPHCTSTN
RTDADWEFEVQRDGDNHGLSDEQCQIAFPKLFVEIEKTVSLRKERPITFKEVDDVVVEDG
MVRAAIWRGELYILDYAAQPYTYSRAKATLNSLHRALQSFPDRHSLPDIEFVFTADDFSN
VPGPVWSYSKRDEDESIWLMPDFGYWAWPEVKVGPYKDIRRRIAAVDEGEVHPDGSLVPG
MEFKEKKKQLVWRGSVATNPEVRGKLLKAAQGRSWASIRVIDWDNENDVRYNLLPMEEHC
RYMFLAHTEGRSFSGRGKYLLNCRSVVVSHKLVWREAHHAALVASGPEANYVEVERDFSD
LDRKISFLIDNPEIAERIADNAVRAFRDRYLTPAAESCYWRHLIRQYAASCDFEPVLYNS
QQNGKQQARGVPFESWLLTGSRVK

Enzyme Prediction     

No EC number prediction in EAW19039.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	166	408	2.9e-30	0.972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	5.21e-28	89	415	7	327	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	2.73e-23	166	408	2	250	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13796.1|GT0	6.64e-244	1	440	1	441
BCS02108.1|GT0	6.64e-244	1	440	1	441
UDD61446.1|GT0	9.95e-238	1	438	1	436
QMW41857.1|GT0	2.34e-232	1	438	1	458
QMW29784.1|GT0	6.68e-232	1	438	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	4.28e-13	166	408	94	339	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	3.99e-10	165	414	127	382	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NBL1|PGLT1_HUMAN	2.68e-12	166	408	122	367	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	6.67e-12	161	414	133	391	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	2.82e-11	161	414	132	392	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8BYB9|PGLT1_MOUSE	3.59e-11	164	408	120	367	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2
sp|G3V9D0|PGLT1_RAT	6.38e-11	166	408	122	367	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999716	0.000319

TMHMM  Annotations     

Start	End
13	35