CAZyme Information: EAW19013.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW19013.1
• CAZy Family: GH16
• CAZyme Description: glycosyl hydrolase family 2, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603		67901.39	5.1372

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027696:5186743-5188890(+)

Full Sequence      

MSLKSVVIIIMLGRLQVGTNPWPEYPRPQLERSEWQNLNGIWQYQNAPGLEAVQAPPFGQ
ALTNEVLIPSCLESALSGIQGNHTLYSWLSTTFTIPKGWKHQNVLLNFGAVDYEATVFVN
GKQAGFNRGGYFSFTLDITQFVSFDGANELLVFVHDPTDSGDYVIPIGKQRLIPAHIFYT
PCSGIWQSVWIESAPANYITELDISAGMDGQVNVTAVSASGKSTPVDITVFDGGSDKKVA
SHKGTSDQPFSFKVESPKLWSPDSPTLYNISVKMGADEVKSYTGFRTISKGTVNGILRPL
INGEFTFVFGTLDQGYWPDGIYTPPNREAMVYDLHFLKSLGFNMLRKHIKVEPALFYRAC
DEIGLLVVQDMPSPRPLQSRKLSNCNDQTILPDAAQQEEFNRQLELLVKQHRSYPSIFSW
VIYNEGWGQRTDYYPEIELTERVRQLDPTRLVDATSGWIDHGHGDFSDNHHYSYPQCGTP
FYSIQSIPHDPSRIAIQGEFGGVGTNVSIEHLWNNIDAINAINQTYEMADNFDIWNYRSH
LLLSELKDQITRFSCSGGIWTQTTDVEGEVNGLLTYDRRLKRVDEKMWKDDIQALYDAAK
ART

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	30	477	1.5e-98	0.5079787234042553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	9.44e-35	27	452	3	445	beta-D-glucuronidase; Provisional
225789	LacZ	7.44e-32	28	501	6	511	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236673	ebgA	1.22e-21	33	466	39	478	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	3.20e-13	87	195	67	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
395572	Glyco_hydro_2	6.47e-12	196	286	4	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAL93747.2|GH2	0.0	16	603	50	637
BCR96616.1|GH2	0.0	17	603	49	633
BCS09120.1|GH2	0.0	17	603	49	633
BCR88823.1|GH2	0.0	17	602	50	634
BAE58640.1|GH2	0.0	16	602	63	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	4.91e-115	23	590	27	577	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6XXW_A	9.64e-24	25	452	23	444	Structure of beta-D-Glucuronidase for Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6D50_A	2.60e-21	28	425	28	426	Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
5UJ6_A	3.41e-21	36	425	28	418	Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D8G_A	3.44e-21	28	425	28	426	D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPJ7|PLH8_FORAG	8.61e-25	8	545	29	576	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|T2KM09|PLH16_FORAG	1.76e-23	88	457	109	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|P77989|BGAL_THEP3	1.42e-19	82	450	53	410	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|A1SWB8|BGAL_PSYIN	1.58e-17	93	460	126	491	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1
sp|A0KQH4|BGAL_AERHH	8.34e-17	90	460	127	493	Beta-galactosidase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999737	CS pos: 21-22. Pr: 0.4874

TMHMM  Annotations     

There is no transmembrane helices in EAW19013.1.