CAZyme Information: EAW19003.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW19003.1
• CAZy Family: GH15|CBM20
• CAZyme Description: cutinase family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342		32914.95	5.2368

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027696:5159253-5160355(-)

Full Sequence      

MKVSATTVVLLAGLAAGAPTKTIHSELEKRQFGTGTDGLGALASIFPILGGGGSSTSSGL
GALASLIPGLGGSSSSGSGFSLPGFTLPTSIPGLGSLGSLGSSGSSSGASGLSGLSGLGG
LSGLNGLSASTTDSSAEASTSGTAATSSDSNSGVALSGLLGGSITENGVKNKDACQPLTF
IFARGTSELGNMGSIAGPPVATKLRSLLNNKVVVQGVDYPASIEGNAMLGAAGGPTMASL
VKQALSQCPDTKVVVGGYSQGAMVVHNAANSLSEGQIAAAVLFGDPFKSQAVGKVDKADV
KEYCAAGDPVCLNGVNVLAHLSYGDDAAEAAQFLVTASGVKA

Enzyme Prediction     

No EC number prediction in EAW19003.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	174	336	1.9e-42	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	4.22e-44	174	335	1	170	Cutinase.
223477	YpfH	5.76e-04	229	342	75	179	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR89623.1|CE5	3.72e-86	165	340	103	278
QQK39777.1|CE5	1.51e-82	152	339	87	275
CAP91879.1|CE5	2.08e-80	162	339	144	321
QRD85183.1|CE5	4.84e-79	156	340	130	327
BAE58644.1|CE5	1.47e-78	166	340	36	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	7.49e-37	155	335	64	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	7.15e-28	175	339	21	197	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	5.68e-27	175	336	12	185	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	1.50e-21	175	334	23	194	Chain A, cutinase [Malbranchea cinnamomea]
5AJH_A	2.69e-21	160	335	16	206	Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005],5AJH_B Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005],5AJH_C Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	2.97e-76	160	340	45	223	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	8.29e-39	174	340	30	202	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|A8QPD8|CUTI1_TRIHA	6.12e-37	163	334	72	243	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|G0RH85|CUTI1_HYPJQ	3.31e-36	155	335	64	244	Cutinase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_60489 PE=3 SV=2
sp|A0A024SC78|CUTI1_HYPJR	3.31e-36	155	335	64	244	Cutinase OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=M419DRAFT_76732 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002195	0.997778	CS pos: 30-31. Pr: 0.7004

TMHMM  Annotations     

There is no transmembrane helices in EAW19003.1.