CAZyme Information: EAW17531.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW17531.1
• CAZy Family: GH109
• CAZyme Description: UDP-glucoronosyl and UDP-glucosyl transferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542	DS027696|CGC28	60851.43	7.7875

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027696:624232-625918(-)

Full Sequence      

MSEITTPPRKILLVVTGGGYTHAAPVLELGKILANRGHVIDFATLDGQEKWTDGFPISHT
HLMGPGPTEEQLDAHYKRSRLWDPAKGLGDIMDSKYLFDSLWTQTYHRLKEIMADPATRP
DMMVADFFVDAVKDIHFEYKLPIAIMWPQMPYMMVPCSYIPGQPGFQLDMTLTSENASMW
SRINNELVVVRALPEALKLMKWTKAMRKRAGLNYLFPTPTKPDYLVMINSFFGLDVPKDL
PPLVAAVGPILADEYPPLDDIHQRFLDQHAKTIYVALGTHIILPHADARKIINGLIQAMD
AGLINGVIWSVGKSGRQLFDTADEFTINGQTVRFGDLLDGKLADWLFPFFAPQRSILDHP
HARVYFTHGGGSSANEGLYHGKPMLVMPFFFDQIGNAAKLAGSGTSEVLHKFRFTAEDVY
TKTKLILEDREGAYARNVLRLQRIAHVTSRRKQLGADLIEEVLYDTELRVVDGKETRPMH
LQTADMRMPVYKARNWDLMAVSGLVMGLLGGGTYYAARLAWMHRRAVRNFVDSLVRGSVV
GG

Enzyme Prediction     

No EC number prediction in EAW17531.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	122	436	2e-26	0.680628272251309

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	7.39e-42	13	445	4	389	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.19e-26	10	463	3	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	2.56e-15	342	446	326	423	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	5.74e-11	241	444	264	445	ecdysteroid UDP-glucosyltransferase; Provisional
177813	PLN02152	3.60e-07	139	445	126	433	indole-3-acetate beta-glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46937.1|GT1	0.0	1	535	3	522
QLI65751.1|GT1	5.70e-249	1	538	1	537
QKD56593.1|GT1	1.33e-248	7	536	6	537
QKX59607.1|GT1	6.41e-238	5	538	6	544
BCR88254.1|GT1	1.73e-232	1	524	1	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	8.17e-13	341	446	93	191	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	1.23e-10	341	440	72	164	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2VCE_A	3.59e-08	120	440	111	440	Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VCH_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VG8_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana]
6PNT_A	1.78e-07	260	429	260	401	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]
4M83_A	2.97e-07	332	463	276	398	Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus],4M83_B Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8JZZ0|UD3A2_MOUSE	1.03e-16	225	455	246	457	UDP-glucuronosyltransferase 3A2 OS=Mus musculus OX=10090 GN=Ugt3a2 PE=1 SV=2
sp|O75310|UDB11_HUMAN	1.02e-15	131	446	162	450	UDP-glucuronosyltransferase 2B11 OS=Homo sapiens OX=9606 GN=UGT2B11 PE=1 SV=1
sp|O02663|UD2B9_MACFA	2.38e-15	90	446	129	450	UDP-glucuronosyltransferase 2B9 OS=Macaca fascicularis OX=9541 GN=UGT2B9 PE=2 SV=1
sp|P36513|UDB14_RABIT	9.81e-15	135	446	167	451	UDP-glucuronosyltransferase 2B14 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B14 PE=2 SV=1
sp|Q63886|UD11_MOUSE	9.94e-15	112	441	150	445	UDP-glucuronosyltransferase 1A1 OS=Mus musculus OX=10090 GN=Ugt1a1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000002

TMHMM  Annotations     

Start	End
496	518