CAZyme Information: EAW17374.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW17374.1
• CAZy Family: GH10
• CAZyme Description: beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
955	DS027696|CGC25	106371.59	5.8957

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027696:214412-217279(+)

Full Sequence      

MRESILSVLIFFSLLLIAQARDDGRMKYNFNSGWKVLVGNPASAQSPSFNDNGWKDATLP
HSWNEDDAFRVDIANLSTGIAWYRKHFDLPATSRNKKVFLEFEGIRHAGEFYLNGKWIGR
SENGVMAFGFDVSDVTLYNQTNVLAAQIDNSWTYREKATSTPYQWSDKNFYANYGGINKN
VFLHVTDRLYQTLPLYSNLQTTGVYIYATDLDIPRKSATINIESQVRNEYPQARTFQYQV
EIHDAVQGKKLKTITGGRYTLQANETRTIRTATHLSDINFWSWGYGYLYDVRTSLLLNNH
AIDSVKTRTGFRKTEFTHGAFKLNDRTLHLKGYAQRTTNEWPALGCAVPPWLSDFSNSLV
LASNAALIRWMHVTPWKQDVESLDRLGLLQALPAGDSEGDATGRRWAQRTELMRDAIIYN
RNNPSVIFYEAGNHGVSEAHMSEMKALRDTYDPHGGRAAGSREMLNSSVAEYGGEMLYIN
KGARIPLWQMEYSRDEGLRKYWDDWSPPYHVDGAGPPYKGEDASEYNRNQDSHAVENVRR
WFDYFEQRPGTGTRVNAGGVNIIFSDSNTHHRGAESYRRSGEVDAVRLPKDGWYAHKVMW
DSWVDVERLAGHIIGHWNYNDSTVKDVYVVSTAEEVELFLNGKSVGKGEQSSRFLFTFAN
VTWQSGTIRAVGQLGARGSVLDTKTTAGEPASIRLTPHTGPSGFVADGADIALVDVEVVD
AEGQRNPIALSIIDFALSGEASWRGGIAQCADNCILSTTLPVENGINRVMLRSTTRAGKV
TLTATSDGLKPATIILNTKPFASKGGLSTVIPGSDLPFVLSRGPTPSSESYTISRKAVEV
LNVTAGCDTEDMISSYDDDEETEWSCDGNKNSTWIKYSWDGPVNVSQMVMKLHSFRTTKY
PVQISVDDNVVYEGSTPTSLGYVTLDLNATVGQSVTVASEDGDLGIIEAEIYAPA

Enzyme Prediction     

EC	3.2.1.31:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	21	467	4.7e-60	0.4933510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	4.63e-23	54	592	42	564	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
408349	Glyco_hydro2_C5	5.07e-18	693	794	1	102	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
236673	ebgA	6.83e-18	11	332	21	338	cryptic beta-D-galactosidase subunit alpha; Reviewed
236657	PRK10150	3.52e-16	79	333	65	297	beta-D-glucuronidase; Provisional
406696	DUF4982	3.81e-12	623	672	2	52	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCM93650.1|GH2	0.0	20	954	35	1000
BBB61369.1|GH2	0.0	25	937	4	915
QNA42647.1|GH2	0.0	9	954	4	980
QEC55412.1|GH2	0.0	12	952	9	985
QEK53149.1|GH2	0.0	19	953	26	960

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	1.73e-164	25	826	35	831	The structure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
7CWD_A	1.34e-57	27	804	3	807	Chain A, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	3.23e-53	23	789	5	798	Chain A, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T98_A	1.06e-47	29	799	29	821	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4CUC_A	4.41e-39	27	790	15	836	Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KN75|PLH17_FORAG	6.99e-164	25	826	26	822	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
sp|A7LXS9|BGH2A_BACO1	3.68e-44	25	799	42	849	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
sp|T2KPJ7|PLH8_FORAG	5.12e-34	23	691	49	717	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	6.15e-33	24	786	2	725	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|T2KM09|PLH16_FORAG	3.56e-31	14	740	35	759	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000198	0.999777	CS pos: 20-21. Pr: 0.9814

TMHMM  Annotations     

There is no transmembrane helices in EAW17374.1.