CAZyme Information: EAW17149.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW17149.1
• CAZy Family: CE4
• CAZyme Description: chitin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
788		88843.12	9.0051

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027697:1335714-1338421(+)

Full Sequence      

MTSWQRRQTVTAASGLRRYPTRRINLVQGSVLSADYPVPSAIRNSVEAKYRDSNGTSAEE
FTHLRYTAATCDPDDFNLRNGYNLRTAMYNRYTELLIAITYYNEDKVLTARTLHGVMQNI
RNIVNLKKTQFWDKGGPAWQKIVVCLIFDGIGPCDKDVLDVLATIGIYQDGLMKHDVDGK
ETVAHIFEYTTQLSVSPSQQLVRPLADDSANLPPVQMIFCLKQKNSKKINSHRWLFNAFG
RILNPEICILIDAGTKPGHNSLLALWEAFYNNKNLGGSCGEIHALLGSRWEKLVNPLVAA
QNFEYKISNILDKPFESVFGYVSVLPGAFSAYRYRAIMGRPLEQYFHGDHTLSKRLGKKG
IDGMNIFKKNMFLAEDRILCFELVAKTGSQWTLSYVKASRGETDVPEAPAEFLSQRRRWL
NGSFAASLYAVMHFSRVYKSGHNILRLAFLHVQLLYNIFQLTMTWFSLASYWLTTSVIMD
IVGTPSATNKNKGWPFGNDASPVVNNVIKALYLAFLMQQFFLALGNRPKGSQFAYILSFL
YFSLVQLYILILSFYLVTQAFSGGNMDLDLDHGAQGLLESFFTSTTGLVLVALASTYGTY
FIASVLYCDPWHLLTSSWAYFLGMPSTINILNVYAFCNWHDVSWGTKGSDDAASLPSAQT
EKSAAQKTFFEEVDKPQADIDTEFELTVRRALAPWQKPTEKKEAQLDDSYKTFRTNLVLL
WALSNCLLALLINNASVTNLCLTTTSTDRTAWYFKVILWATSGLSIFRFLGALCFLGKTG
VLRCLSRR

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	101	269	2.2e-70	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.76e-97	101	269	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	1.62e-89	97	426	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	1.96e-30	23	100	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	6.93e-23	205	558	102	400	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	2.66e-18	235	421	187	372	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS00643.1|GT2	0.0	2	788	87	871
CAK38392.1|GT2	0.0	2	788	87	873
EAA60528.1|GT2	0.0	15	788	109	905
QRD88403.1|GT2	0.0	3	788	119	903
QKX54176.1|GT2	0.0	3	788	113	895

PDB Hits     

EAW17149.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92197|CHSC_ASPFU	0.0	1	788	105	893	Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsC PE=3 SV=2
sp|P30602|CHS3_EXODE	0.0	3	736	118	856	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2
sp|P29070|CHS1_NEUCR	0.0	3	788	125	917	Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-1 PE=3 SV=2
sp|Q00757|CHSB_EMENI	0.0	3	788	127	916	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|P54267|CHSG_ASPFU	0.0	3	788	123	911	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000012

TMHMM  Annotations     

Start	End
461	483
503	525
535	557
577	599
614	636
718	740
755	777