CAZyme Information: EAW17138.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW17138.1
• CAZy Family: CE4
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1324	DS027697|CGC2	145237.94	4.6677

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027697:1288267-1292573(-)

Full Sequence      

MVKNALAVLTQVNKDRVENPNFNQYTFQEPRQTKASFATAPPLDYSPEAVENARLRKREA
TSATTRGNRAYTIPPELARAAKVVAESADNTPSGNHSDVAADIRRKYGQGKRQSNTPPQA
LVQSNGLYDFQSFAENVNMSLVDQQSNSGLQKRAPSLYWMPHMEKNGHSPFAPTGYKIWR
NVRDYGAKGDGVTDDTEAINRAISDGGRCGADCGSSTRYPAVIWFPGGTYLVSSSIIQYY
NTQFIGDPLNVPTILAASSFVGLGVITSDPYVSDNGQWYVNQNNFLRSIKNFKIDIRPTD
PSAYVCAIHWQVAQGTSLENIEFYMLYNSDVPGNTQQGIYMENGSGGFLTDLTFVGGNFG
AYFGNQQFTTSQLVFVKCHTALQVHWDWAWTMQDYVIESCTNGLVIVGGAGGPMSNGQGV
GSLILADAIIANTPNGIVTSLHTENSTSLLLQNVGFFNVKTAVVDSVKNQVLLPGGNEVL
KDSWGFGMVNNATGVGSFVNGQDIPVMNRTEKMLGSQAYVKPNLFTRRRPQYEDLSTADI
VNVKLFGAKGDGSSDDTVVLNWILEYAANLSSVVYFPYGVYMIRDTLKVPVGSRVMGQAW
PQIVATGSKFEDINNPYVAVKVGNPGDVGIIEIQDMMFTVSGPTAGAVLVEWNVEQSVKG
SAAMWDSHIRVGGAIGSKLQREQCPKQTRRVNPNCIAASLLLHLTPSSTAYLENIWVWVA
DHDLDVITQDQIDIYSARGILIESQLAWLYGTTSEHNVMYQYQLSGAKNILMAMIQTESP
YYQPVPLAPNPFTPGAFPDDPLFDDCKSNPLKCAVSWAVRIIDSSSVWILGSGLYSFYSD
YSQDCLKTENCQQRGFEIEQSSDIWIYNLCTKAIVEMVTPFQGVPTYARDNVNGFLSSIL
AWLGGAEQTAGQREFPGFSIYTSSGLEDADLPRACKNSLAERIKCDPHLSSMMELSYHGS
LDNDTLTDLVCDASCEASLRQWYNSVERNCAGYMMPGGSPPVVFGARMWAGFNETCSKDK
GTGEYCNAIIDGFTIVESTDEMPDNEICSYCYVERFQMMQRSPYSAYNEHYKSVLETINK
RCGLSGPTDIREVPMDMPVEEEKPICLSDTTYTTVDGDTCTSIAVANSVSSAALYIGNQH
LIRWCSSIKAGLELCLPLPCERTYTLQPSDDCASIEYAFSLKYGDVRKYNPWVSYDCDNI
QIASKIYGTNICLSPQGGEHITNKTSHGATTPSTSDGHAPLAVPPPANASLADGTTTNCG
RWHEAAADESCVAICVQNSITHELFVQVNPSLNAKDCTRSLQVGKTYCAGPTYFWNEPFE
DDEL

Enzyme Prediction     

EC	3.2.1.58:16	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	150	902	5.8e-276	0.9905405405405405

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	3.62e-95	179	404	1	212	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	1.14e-09	540	658	1	127	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	2.63e-05	181	343	84	253	Polygalacturonase [Carbohydrate transport and metabolism].
314993	End_N_terminal	1.82e-04	187	249	1	59	N terminal extension of bacteriophage endosialidase. This domain family is found in bacteria and viruses, and is approximately 70 amino acids in length. This domain is found in the bacteriophage protein endosialidase. The two N-terminal domains (this domain and the beta propeller) assemble in the compact 'cap' whereas the C-terminal domain forms an extended tail-like structure. The very N-terminal part of the 'cap' region (residues 246 to 312) holds the only alpha-helix of the protein and is presumably the residual part of the deleted N-terminal head-binding domain. The endosialidase protein complexes to form homotrimeric molecules.
212030	LysM	0.002	1110	1156	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA66649.1|CBM50|GH55	0.0	1	1323	65	1378
EAA67102.1|GH55	0.0	1	1322	66	1375
ATY64695.1|CBM50|GH55	0.0	1	1320	61	1369
UPK93980.1|CBM50|GH55	0.0	1	1317	52	1357
CZS83162.1|GH55	0.0	1	1315	51	1351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	6.89e-207	154	902	2	752	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	3.58e-191	158	902	26	755	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
7CHU_A	5.68e-08	181	371	76	272	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	1.10e-205	156	899	41	870	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	2.75e-156	142	899	26	781	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	1.87e-57	146	894	26	748	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1
sp|D4AY86|LYSM6_ARTBC	7.17e-07	934	1318	40	428	LysM domain-containing protein ARB_01155/01156 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01155/01156 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EAW17138.1.