CAZyme Information: EAW17098.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW17098.1
• CAZy Family: CE4
• CAZyme Description: bacterial alpha-L-rhamnosidase domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813	DS027697|CGC12	87693.06	6.5478

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027697:1175928-1178430(+)

Full Sequence      

MRLSSPLLFGGALQATSGCATLLVPLTYRDHHGTPHAVHNGTTYTLSSNDTSPSIIILDY
GRDVEGYGTFHVSRRSGNTSVFEMSYSETDALLDTYMADGPLPLAAAMDTYRINRYNITE
QKTYTNRLIQGALRYQKLNLSSDGELELSFVGFKPAVHEVPLSGLPGSFNCSDPVLNRIW
EIGARTVQLNEFPARSLPNFWILTEEGAMVDSLAPQPFAADFAATMSAYKVAFSVKPVAH
GFGFTVLSDTLGNGVYIFVDVVNSSISAHAGSTEIGKPPLASAVLPPSVTLHQWHTVEAT
VNVTQISIKLNGNSVLDFSQTAAFYGSFGLGASFGHRAVFANASLMAFGMEMYSSSLTDK
SALKDFLLGTNPLPVSVDGSRRDRIAYAGDLDITARTAFASTNGLEYINGSIALLGSMQM
LPGFFTPTAKVQQEPRVEPIQANITGLIGYSFSLVSSMAQYYEQTGDVTFLRHWAPRVGR
LFDWAHSQTLPSGLLNISDASFGGDWNYYDPPLSGVVSKFNLVYAYALKQWLPYMADGGL
NATMYANRLQSLQRAIATNLWSDELQAFYLSDSHKDFFSQEANALAILSDTVPLIGNRSA
STILSSMARDLYVPAGALAFSNASAASGWARKISPYASGYHLKAAFHANDPTSAERLLRS
VWGPMSDPSLANYTACTWETLDPDGTPGLGASTSLCHVWGAGPTADLSRYVLGVQAVTPG
FKEWKVQPQTLGLEYARGKHPVPQGSIQVDWSFGNDGLLNMTVTAPAGTKGIILPPSPLK
VTLSKYRVSGHAKKVGEGFIIQGGQAFTLQQSR

Enzyme Prediction     

No EC number prediction in EAW17098.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	372	773	3.3e-69	0.7301587301587301

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	8.20e-10	713	778	1	67	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	3.41e-04	461	711	110	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD63660.1|GH78	0.0	10	812	230	1030
BCR85243.1|GH78	0.0	12	811	13	808
QMW46762.1|GH78	0.0	10	812	17	817
QMW34696.1|GH78	0.0	10	812	17	817
QRD93478.1|GH78	0.0	29	812	232	1013

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.58e-15	377	749	331	674	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

EAW17098.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000001	1.000082	CS pos: 18-19. Pr: 0.9845

TMHMM  Annotations     

There is no transmembrane helices in EAW17098.1.