CAZyme Information: EAW16959.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW16959.1
• CAZy Family: CE16
• CAZyme Description: glycosyl hydrolase family 76 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459	DS027697|CGC13	50270.99	4.5559

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027697:708698-710228(+)

Full Sequence      

MRLQSLPRLGWNALWTTLIFSSLAQAIDVNINDDQSIKNAASTAAYGAMSYYHGNESGQI
PGAFPTKWWEGSALFMAMLQYQYFTGDHTYNSEVSLGLQWQAGEGDYMPSNYSSYLGNDD
QMFWGLAAMLAAELQFPDRSEGYSWLSLAQGVYNTQVDRWDTSTCGGGLRWQIYTYQAGY
TMKNAISNGGLFQLAARLARYTNNHTYYEWAEKVWDWSCSSPLLNNKTWSVADSTNIEDG
CESQGNNQWSYNYGAYLMGAAYMWNYTNGTNTKWATAVDGLLNNTLDLFFPTKYGGNIMS
EVLCEPNEVCNNNEILFKGLVASWLAFTALLVPSTYDRILPKLQGSAVAAGATCTGNGNN
SCGVRWYTSKWDGWTGMEEQISVTDVLSVNLITTKHKGPVTSTTGGNSTSDPTAGSGDKS
GQTTPTRKITTGDKAGASILTIGFAVGWVGLMAFMVIGG

Enzyme Prediction     

No EC number prediction in EAW16959.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	34	401	4.3e-96	0.9608938547486033

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.57e-177	36	383	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	0.007	111	257	82	215	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR86001.1|GH76	7.92e-235	13	457	13	461
BCS03764.1|GH76	7.38e-234	25	458	21	455
BCS15380.1|GH76	7.38e-234	25	458	21	455
CAK47058.1|GH76	1.09e-233	25	458	21	456
BAE55608.1|GH76	1.11e-231	25	442	25	442

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	8.94e-89	31	434	30	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	1.88e-104	18	441	13	433	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	2.15e-101	17	415	11	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	2.90e-101	19	457	11	452	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	1.92e-100	27	441	19	430	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q9P6I3|YHG7_SCHPO	1.20e-97	31	445	24	430	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999752	CS pos: 26-27. Pr: 0.9784

TMHMM  Annotations     

Start	End
435	457