CAZyme Information: EAW16810.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW16810.1
• CAZy Family: CBM67|GH78
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545		57303.79	4.8932

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027697:300669-302378(-)

Full Sequence      

MPHDGWREMLPYYISMYKSGTATVTEERLVAWYRVNKNGACSDGGTTGNTANQLQFEYSP
NVMMEDRVFYDVLLTSNAQVQVSIGGVTQAGRWDQEPHGGVGVYHGSVPIGTASGQVVVT
VKRGGTTIATIAGASITSSCNGGLNNYNPWVGSARGPSITPVKTTGDLSKLDCVKGFGVF
DFIGVCDFACANGYCPSAACTCLKKGVANAPNDTGLAGYPLPGKSGSFAGLCSFDCNHGY
CPDSVCGQTPNDGVVLGYSPFLPPACTGGTGAGDFQGLCDFGCHLGFCPIHACTCTSTGI
LVQTPPKMNVTGYYLNSSKNDYGLCKFACEHSYCPDVCGSRPINDDGHQSKYPTVTLDPA
VWTAPTAQCAPPYVLVLPPSSLATPTTISFNPWPTSLEFGWIATDTVDSTRTTRYTAVTI
TTEISIPPVTTDLISFSEVVLTTTVDGGVPSIIIPTASISPPPFVITLITIPDITATPVP
RTIRPPPWPWSGASAMPDPSRTSATTSTSGPIVVVPIVTGPFPTTVFPTETVSWVRDWVP
EPTAT

Enzyme Prediction     

EC	3.2.1.59:6	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM24	265	337	1.2e-23	0.9605263157894737
CBM24	173	246	1.6e-22	0.9736842105263158

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	4.42e-43	1	130	255	372	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	3.08e-05	1	20	264	283	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA15443.1|CBM24|GH71	3.26e-74	1	511	438	958
VBB73755.1|CBM24|GH71	1.04e-70	1	489	230	721
CAB92025.1|CBM24|GH71	3.51e-69	1	489	279	754
EAA33915.3|CBM24|GH71	6.72e-68	1	489	288	763
ATZ51352.1|CBM24|GH71	1.42e-67	1	440	277	731

PDB Hits     

EAW16810.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6GX22|MU71A_PENRW	4.29e-08	1	156	291	432	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EAW16810.1.