CAZyme Information: EAW16796.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW16796.1
• CAZy Family: CBM63
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415		45529.22	7.2835

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027697:250762-252009(-)

Full Sequence      

MKLFQISCLSLFVSLSSSLSLPNGHGRHDIIPKTVVIDGARLVENKLRLRAGDASLTAAL
GHLTTEADSWLSQGPWTVTSKTQAPPNGTIHDYASQAPYWWPSNTTDGCPYVDRDGERNP
EVEKYPDHSGRDSMFRSSYILSLAWYYTGQAKYAKHASLILQTWFIDPATAMTPNLRHAQ
IIPCRNDGRSIGIIDFSMEYTNVLDAAAILASTNAPGWTRANQRAFMNWNRQFLDWLVNS
PFGKEEAGQENNHGTFANMQIAALALFTGNTSLSKKTSQGAKSLIDVQIRPNGSQPMELA
RTRSWHYSNFNLGAHLRFALVAKKVGVDLFGYKGPDGQSLFGATNFLLRAAVEGRSAWGF
EELEFKPYAATDNVHAAADAGDSQAKAVVPQLPPPPTGDIYLLRPAAEQLDNIAG

Enzyme Prediction     

No EC number prediction in EAW16796.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	78	351	1.2e-98	0.974910394265233

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	7.52e-95	77	358	1	274	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
234727	algL	0.003	251	363	194	300	polysaccharide lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT05465.1|PL38	3.56e-188	10	414	5	416
UKZ57530.1|PL38	2.37e-186	30	414	32	416
UKZ83240.1|PL38	2.37e-186	30	414	32	416
OTA06285.1|PL38	1.52e-185	31	414	35	419
UKZ91858.1|PL38	5.41e-183	30	414	33	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	3.57e-59	46	364	16	334	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

EAW16796.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000283	0.999697	CS pos: 18-19. Pr: 0.9736

TMHMM  Annotations     

There is no transmembrane helices in EAW16796.1.