CAZyme Information: EAW16736.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW16736.1
• CAZy Family: PL1
• CAZyme Description: GPI-anchored cell wall beta-1,3-endoglucanase EglC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450		44878.34	4.5163

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027697:76828-78238(-)

Full Sequence      

MQFTQLVALALALATSEAAHQGFNYGNTKSDGSAKSQSDFQAEFSTAKNLVGTSGFTSAR
LYTMIQGGTANTPISAIPAAVAEETSLLLGLWASGGNFANEIAALKTAIADYGDDLAKLV
VGISVGSEDLYRNSVDGVKAKAGLGTNPDEIVSYINQVRSTIAGTKLSGAPIGHVDTWTA
WVNGSNSAVIDACDWLGFDGYPYFQNTMANSISDAKALFDESVAKTEAVAKGKEVWITET
GWPVSGNTENLAVANLANAKTYWDEVGCPLFGKTNTWWYILQDANPVTPNPSFGIVGSTL
STTPLFDLSCSASSSAAASSTAVPSASSVAGAKASGFATAAASSGAAGSAKPTFTVGKGP
GGSYNGTGFWNSTSSARPSSTAISGSSSGSASGSSGSSGSGASGASGQSSSSTGSSSAPS
SSNILSNAASGLSGSIFGAVVAVCLALAAL

Enzyme Prediction     

No EC number prediction in EAW16736.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	6.00e-29	22	273	47	272	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.49e-07	22	285	2	283	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAL86311.1|GH17	8.37e-245	1	450	1	446
BAE54624.1|GH17	5.26e-181	1	322	1	322
CAY05237.1|GH17	5.26e-181	1	322	1	322
UCK57187.1|GH17	5.45e-181	1	322	1	322
QMW36860.1|GH17	6.71e-181	1	322	7	328

PDB Hits     

EAW16736.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DJ47|EGLC_NEOFI	5.33e-270	1	450	1	450	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	1.27e-247	1	450	1	450	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	1.49e-245	1	450	1	446	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|A1CD22|EGLC_ASPCL	6.67e-206	1	450	1	453	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	9.34e-182	1	322	1	322	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999774	CS pos: 18-19. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in EAW16736.1.