CAZyme Information: EAW16731.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW16731.1
• CAZy Family: AA9
• CAZyme Description: glycosyl hydrolase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860	DS027697|CGC14	94820.67	5.7505

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027697:59354-62213(+)

Full Sequence      

MANKGMDRSFMTASAEDLVQSMSLTEKVSLLSGEDWWRTTAVPRLNIPSIKLTDGPNGAR
GQSFFKMTPAVVLPNATGLAATFSPTLPAEAARLLAAETKARGAVCLLAPTINICRSPLG
GRTFESFGEDPTLSGIMAAKYVNALQEEGISAAIKHFVANDQEHERMGQDSIIAPRALRE
IYLRPFHIAQALAKPWSYMTSYNKLNGTHCSEHDWLLRGLLRTEWGFDGLVMSDWMGTYS
VAEAINAGLDLEMPGKPRWRQLPLVRQLVNAHKISPATIDERVIAILKWVQKLVVLNPDT
VYGRDDSVEWTRTEDQATDAALIRRIGNEATVMLKNESSVLPIRRGKVAVIGPNAKNAVI
TGGGSARLRPAWCVTPWQGLVDNRPDEVDLRYTLGCKGSKFLPVFGEEFTSMDGTTRGFD
MLHYALVDGKQASQPAVSEVWTNSDIMLADFSHPDLGDDYFTEIRALFTAPITGDWQFEI
SVTGQAWVYIDDRLLADLSKEQKRTSSFFGNGGNGTVITFSVTKGKVYKFRLLHDSRKPP
LAPGQDSQPLQLIGMKLGSFPAINEDQTIDEAVELAKESDIALLVVGLDQDWESESYDRP
DLSLPLRMNDLIRRVATEAPDTKKVVILQTGSAVSMPWLEHVDAVLWPWYGGNEAGNAIA
DIVYGTVNPSGRLPITLPKRELDIAANLNFKSARTKTYYEEGIWVGYRHFNARGIEPMYP
FGHGLSYTTFDYSDLTVAPSASSSPDSWRISVSARVTNTGTVPGAHSVHFYTSPPPPTMT
SLTHPDVTLQAFAKTAVLLPGQSETVTVEMDKFAISHWDELTSTWQAEPGQWHVKIGRDA
QTMCIEAPFNVSPGFKWHGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	41	254	7.8e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.15e-67	44	841	101	755	beta-glucosidase BglX.
224389	BglX	1.61e-59	41	367	54	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.92e-47	556	727	68	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	8.06e-38	11	776	49	712	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.44e-35	44	287	63	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ91447.1|GH3	0.0	1	860	1	860
QKD55271.1|GH3	0.0	1	860	1	860
CBX93190.1|GH3	0.0	1	860	1	861
AUB23806.1|GH3	0.0	1	860	1	862
AFR94189.2|GH3	0.0	1	860	1	862

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.89e-181	16	860	7	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.64e-176	16	860	7	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	8.84e-115	11	856	1	673	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	5.22e-97	17	852	6	714	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	7.42e-96	17	852	6	714	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DNN8|BGLJ_NEOFI	1.31e-202	16	860	15	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	3.67e-201	16	860	7	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	3.67e-201	16	860	7	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q5BA18|BGLK_EMENI	1.46e-200	18	860	16	838	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|Q4WLY1|BGLJ_ASPFU	1.69e-200	16	860	15	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999961	0.000083

TMHMM  Annotations     

There is no transmembrane helices in EAW16731.1.