CAZyme Information: EAW16568.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW16568.1
• CAZy Family: AA7
• CAZyme Description: exo-beta-1,3-glucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804		84094.43	4.8293

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027698:3588864-3591490(+)

Full Sequence      

MHVNWLAASVWLFAGARAQLFSSPIRSPSAAPSSSASGVISASPTVAAAVGHSSNLAAAA
AAAVDDPAYWLADIAHQGIAAFNPNPSSYKVFRNVKDYGAKGDGVTDDTAAINAAMSDGG
RFSPASRDSSTTTPAIVYFPAGTYIISSSIIDYYFTQIIGNPNSLPVIKATPGFTGLGLI
DGDQYQSDGNQGWISTNVFFRQIRNLVLDLTAIPAGTAATGIHWPTGQATSIQNVQIRMS
SGAGTQHQGLFIENGSGGFVTDVTTVGGLYGFNIGNQQFTMRNLHISDAVVGISQIWNWG
WTYQGLTLTNCTTAFSIANGGPGAQLVGSAIVLDSTIEDCPVFVETAWQSSSQSNGSLIL
ENVALNNVPVAVKGPSGTVLAGSGGAMTISAWGQGHKYTPSGPTNFQGAITAPTRPSALL
SGGRYYTKSKPQYEASSTSSFLSVRSAGAKGDGSTDDTAAIQSALTTAVGSGRIVYFDQG
VYKVTGTLYIPPGSRIVGEAYPVIMASGSQWSNINQPVPVIQVGKAGESGSIEWSDMIVS
TQGSTPGAVLIEWNLAASQGSGMWDVHTRIGGFAGSNLQAVQCPTSAAVSAACEAAYMSM
HITSSASNVYLENVWLWTADHDLDNGGDTRISVYTGRGFLVEGKNIWLYGTGVEHHSLYQ
YQFSGSQSVVTSFIQTETPYYQPNPNAANGPYPRNTALNDPDYSSCLPGNCDALGLRVLN
SQNTLIYGAGLYSFFNSYSTSCSDYPGGKCQSEIFSIEGSTSGLVVYALSTVGTTNMIVK
DGVSLAVYSDNLATYADTIAYFTL

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	61	803	9.9e-283	0.9918918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	4.64e-93	92	315	1	212	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	5.34e-11	441	554	1	122	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	5.48e-04	434	489	75	130	Polygalacturonase [Carbohydrate transport and metabolism].
227721	Pgu1	0.002	94	222	84	254	Polygalacturonase [Carbohydrate transport and metabolism].
314993	End_N_terminal	0.002	100	118	1	19	N terminal extension of bacteriophage endosialidase. This domain family is found in bacteria and viruses, and is approximately 70 amino acids in length. This domain is found in the bacteriophage protein endosialidase. The two N-terminal domains (this domain and the beta propeller) assemble in the compact 'cap' whereas the C-terminal domain forms an extended tail-like structure. The very N-terminal part of the 'cap' region (residues 246 to 312) holds the only alpha-helix of the protein and is presumably the residual part of the deleted N-terminal head-binding domain. The endosialidase protein complexes to form homotrimeric molecules.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK46226.1|GH55	0.0	66	803	76	816
CAP97426.1|GH55	0.0	66	803	75	815
BCR82778.1|GH55	0.0	66	804	43	782
QKX54382.1|GH55	0.0	42	803	43	805
QGA21686.1|GH55	0.0	64	802	46	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EQN_A	8.44e-216	66	803	24	756	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
5M5Z_A	2.74e-208	69	802	6	753	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
7CHU_A	1.44e-06	94	171	76	150	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49426|EXG1_COCCA	5.33e-287	69	801	48	783	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|D4B0V1|E13B_ARTBC	5.15e-202	68	802	42	873	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P53626|E13B_TRIHA	3.29e-61	134	778	97	732	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001485	0.998460	CS pos: 18-19. Pr: 0.9559

TMHMM  Annotations     

There is no transmembrane helices in EAW16568.1.