CAZyme Information: EAW16441.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW16441.1
• CAZy Family: AA7
• CAZyme Description: glycosyl hydrolase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
884		97313.00	6.1007

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027698:3195268-3198085(-)

Full Sequence      

MQVKSESSVPEMGDLQTMNAAVDEVTDSSRAGTPTSQDESTREDAARSVQPNFTSLLPQL
TLEEKVDLLSGTDFVHSSGVSRLNIPPLKLVDSVNGVKGSELHHGVPTAIFPSSTLYGAT
WNNTLMEELGRALAYQAKLKSAQVILGPTINIHRDPRGGRNFECISEDPLLSGQLAAGVV
RGIQSQGVAACPKHFACNESEFKRREYSVAQSHNSRAVREIYLAAFQEMLRRSEPHGLMV
SYNKLNGTHTTEHPFLKEILRDEWAYNGCLVSDWFATKSCAASINAGLDLEMPGPSVFRG
PKLVAAVRDGLVDEKAVDECVSRVLALVEKTRESHSQEPERSEVSPETNALALKIASEGI
VLLKNEQGVLPLDMRRAPKIAVIGVPASEPVVSGGGSASAPPQYLQKPLDYLRDAHPFPS
LVKYARGVNTNRIVPIVPLDCTTSKNGSPGFDVAYFNEGSNMPVCTEHQKTPVVAMVRNL
KPGLMEPGFSYEISTTITPKTTGPHTLAARVTGSFSLFVESKAVLSVPNQHEVTMEDFLF
EPARLEHRISVFMEAGKPYLVRLLSRARIPRENDYEPTPHGATLCYEEFSDERALIAEAV
QVASSADVSIIFAGRNQQYESEGFDLDSMNISEPQVRLIRAVTAVSKKTVLVLNCGNPID
LSPFVNEVDAILNAHFPGQEGGQAIANILTGKTNPSGRLATTWPKKFDEEHVPTYHNFPA
RLTERGYEIKYEEGLQIGYRHPQSQRTAQWQFGHGLSYTTFEYSGLTVSGQEITEEAGDS
DLKISVRVKNTGIYPGHEVVQLYISPPDSTKVWRPARALKGYAKVWILPGESETVTISLN
KKHAFSYWDEDVKQWRLEPGTYRLLVGPFSTPFEIEHSLMWAGR

Enzyme Prediction     

No EC number prediction in EAW16441.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	79	293	1.3e-58	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.37e-70	81	867	100	751	beta-glucosidase BglX.
224389	BglX	2.68e-64	39	417	16	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	5.87e-52	44	879	44	775	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	9.16e-52	558	739	43	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.30e-33	81	327	62	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI65540.1|GH3	1.55e-267	48	881	6	832
CZS83194.1|GH3	9.34e-260	55	875	5	820
QKD60029.1|GH3	1.51e-258	57	867	7	812
UQC84261.1|GH3	2.37e-257	52	867	872	1675
CEF85991.1|GH3	3.44e-257	55	875	5	820

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.33e-136	56	883	9	844	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.09e-132	56	883	9	844	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.49e-127	52	879	4	666	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.41e-111	60	870	12	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.66e-92	56	876	7	708	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DNN8|BGLJ_NEOFI	5.22e-158	50	883	11	863	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	2.32e-155	49	883	2	837	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|P27034|BGLS_RHIRD	1.02e-154	56	866	5	795	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	2.53e-154	49	883	2	837	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	2.53e-154	49	883	2	837	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EAW16441.1.