CAZyme Information: EAW16145.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW16145.1
• CAZy Family: AA3
• CAZyme Description: exo-beta-1,3-glucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834	DS027698|CGC20	94751.48	7.7427

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027698:2331329-2333946(+)

Full Sequence      

MPSHSRSRDRYGGRDSDREARYDYDYARRRYATDDNDDDYDDDELEHGLNERRYRRDGYL
PPRESRTRGYYERDAEGAADEELLGDERNPGPRASRSYGHDYDARRGERSRAREAPRRSE
RHRDRDREGQSRRRAYEDDGRHRTRDGRRERGRESDAEARRSRRREAGRETAARKHQSSD
STNSASHLLSADALARLGAQYEKEERRKRENAKDAAKAERKRQKKRAVVGEESRALRDPP
GESHRDRTKARVASGAYLEEGRSPEMQVRHRGGGGPAMEARWRKEGSWGGTMDDAGGGRP
FWKRKKWIGLGALILILVIVIPVAVVVSKKHDNKSDPADPQGTSPGKSNLDGLSHDSIPA
YAQGTYLDPWTWYDTTDFNVTFTNETVGGLSIMGLNSTWDDSARPNDNVPPLNEPFPYGS
QPIRGVNLGGWLSIEPFIVPSLFDSYSSVAGIIDEWTLSKRLGSSAARTLEKHYATFITE
QDFADIRDAGLDHVRIQYSYWAVATYDDDPYVAKISWRYLLRAIEYCRKYGLRVKLDPHG
IPGSQNGWNHSGREGVIGWLNGTDGELNRNRSLAVHDSVSKFFAQDRYKNIVTIYGLVNE
PLMLSLSVEDVLDWTTEATKLVQKNGITAYVALHDGFLNLSKWKSMLKNRPDKMLLDTHQ
YTIFNTGQIGLNHTAKVNLICNDWYNMIKEINSTSTGWGPTICGEWSQADTDCAKYLNNV
GRGTRWEGTFSLTDSTQYCPTADTGPPCSCANANADVSEYSADYKKFLQTYAEAQMSAFE
TGQGWFYWTWRTESAAQWSYRTAWKNGFMPAKAYAPSFKCGDAVPDFGNLPEYY

Enzyme Prediction     

EC	3.2.1.58:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	472	793	1e-107	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.77e-41	417	810	12	382	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
273727	U2AF_lg	8.79e-05	3	133	8	117	U2 snRNP auxilliary factor, large subunit, splicing factor. These splicing factors consist of an N-terminal arginine-rich low complexity domain followed by three tandem RNA recognition motifs (pfam00076). The well-characterized members of this family are auxilliary components of the U2 small nuclear ribonuclearprotein splicing factor (U2AF). These proteins are closely related to the CC1-like subfamily of splicing factors (TIGR01622). Members of this subfamily are found in plants, metazoa and fungi.
273721	SF-CC1	6.20e-04	3	89	30	113	splicing factor, CC1-like family. This model represents a subfamily of RNA splicing factors including the Pad-1 protein (N. crassa), CAPER (M. musculus) and CC1.3 (H.sapiens). These proteins are characterized by an N-terminal arginine-rich, low complexity domain followed by three (or in the case of 4 H. sapiens paralogs, two) RNA recognition domains (rrm: pfam00706). These splicing factors are closely related to the U2AF splicing factor family (TIGR01642). A homologous gene from Plasmodium falciparum was identified in the course of the analysis of that genome at TIGR and was included in the seed.
237171	PRK12678	0.001	50	142	125	216	transcription termination factor Rho; Provisional
395098	Cellulase	0.001	477	631	24	163	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW27387.1|GH5_9	0.0	1	834	1	831
QMW39458.1|GH5_9	0.0	1	834	1	831
QRD81773.1|GH5_9	0.0	1	834	1	831
UDD55247.1|GH5_9	0.0	1	834	1	831
CAK45960.1|GH5_9	0.0	175	834	171	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2PB1_A	8.36e-75	413	821	5	398	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
1CZ1_A	1.36e-74	418	821	4	392	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
1EQP_A	1.36e-74	418	821	4	392	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	1.57e-74	413	821	4	397	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	2.25e-74	413	821	5	398	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CHZ8|EXGD_ASPTN	0.0	1	834	1	838	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgD PE=3 SV=1
sp|B0Y7W2|EXGD_ASPFC	0.0	1	834	1	833	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgD PE=3 SV=1
sp|B8NNK9|EXGD_ASPFN	0.0	1	834	1	831	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgD PE=3 SV=1
sp|A1CTI3|EXGD_ASPCL	0.0	1	834	1	830	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgD PE=3 SV=1
sp|Q2UMV7|EXGD_ASPOR	0.0	187	834	179	831	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000001

TMHMM  Annotations     

Start	End
307	326