CAZyme Information: EAW15970.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW15970.1
• CAZy Family: AA3
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248		27168.68	5.6079

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027698:1824795-1825653(-)

Full Sequence      

MILIPKALAHMKPGTGTTAGGVNWVGYLTTAENASLVLSYDLAVGGATINGSLVGSTAND
LVGQVKTFDATYSSKPASAPWSFEDAVFAFWIGINDIGNAYYRTNASTFVPQLIGRLEDL
AKDIYSSGGRKFLFVNVPPINRTPMFIQQGDWAIEHSAAYLAFYNQQLATMVERFKSNNT
SVTAVLYDSWSFMTKVLDNPTVYGFPDATCINENGMSCVWWNDYHPGTKYHQRQAEDMKA
SLAPLGAW

Enzyme Prediction     

No EC number prediction in EAW15970.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	12	238	5.1e-87	0.8838951310861424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	4.29e-52	13	240	30	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	3.70e-24	43	226	81	299	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	1.26e-09	40	236	46	222	GDSL-like Lipase/Acylhydrolase.
178701	PLN03156	2.18e-09	83	232	156	336	GDSL esterase/lipase; Provisional
225780	COG3240	1.06e-07	41	243	110	334	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW25447.1|CE16	3.39e-123	14	248	63	298
QMW37516.1|CE16	3.39e-123	14	248	63	298
UCK57868.1|CE16	3.39e-123	14	248	63	298
QRD88580.1|CE16	2.06e-118	14	248	63	313
BCS24928.1|CE16	3.99e-116	14	246	61	292

PDB Hits     

EAW15970.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	1.23e-52	17	236	68	291	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	1.23e-52	17	236	68	291	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|P86276|GDL1_CARPA	2.64e-09	47	205	103	269	GDSL esterase/lipase OS=Carica papaya OX=3649 PE=1 SV=1
sp|Q9SYF5|GLIP3_ARATH	4.43e-07	83	208	154	290	GDSL esterase/lipase 3 OS=Arabidopsis thaliana OX=3702 GN=GLIP3 PE=2 SV=2
sp|Q9FLN0|GLIP1_ARATH	4.48e-07	33	208	108	299	GDSL esterase/lipase 1 OS=Arabidopsis thaliana OX=3702 GN=GLIP1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.885189	0.114839

TMHMM  Annotations     

There is no transmembrane helices in EAW15970.1.