CAZyme Information: EAW15728.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW15728.1
• CAZy Family: AA14
• CAZyme Description: mannosyl-oligosaccharide glucosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822	DS027698|CGC21	92749.89	4.6972

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027698:1038377-1041230(-)

Full Sequence      

MHFPNLHFLLAPFLYNVVVSAGQASAADDLSVLTTQTAKANNDSLLWGPYKSNLYFGVRP
RIANSLSAGLMWAKVDNYATAQASFRHTCEQNEGMAGYGWDEYDIRKGGRQTIHDTGNSL
DLTIDFIKVPGGQHGGSWAARVRGVPREDGSPDQPTSIVFYATLEGLGNLGVATVSGPLG
YEGDVKLTGYTTELGDFSIDVTAGPETNEHPEHGHPSYEDKPLDRTLVSSSTIAPENLWQ
VKPILFAQMKSEVNEMIQRFGQENPPPPAQVFTIKNAPGDGNIHLIQKVFKGAFEFDILF
NSGSSPDPVTSDKLTEVISSASQSFSERFNKVLPPQSPFKTAEYSEFSKAMLSNLIGGIG
FFHGDDVVDRSAAPEYDEENEGFWEETAEARARAQPVLEGPKDLFTCVPSRPFFPRGFLW
DEGFHLIPVIDWDTDLALEIVKSWLNLMDEDGWIAREQILGAEARSKVPPEFTVQYPHYA
NPPTLFMVLEAFLDKLEASKGAYSQNSGGQGALDSLRMTYLQKPELGEAFIRSIYPLLKR
HYFWYRTTQKGDIKSYDREAFSTKEAYRWRGRSVQHILTSGLDDYPRPQPPHPGELHVDL
ISWMGMMTRAMRRIAEFVGETEDVEEFRGYETAIERNIDDLHWDEEAQTYCDATIDEFEE
SVHVCHKGYISLFPFLTGMLGPDSPRLKAVLDLIRDPEELWSDYGIRSLSKKDEFYGTAE
NYWRSPIWMPINYLVVENLYDIATTSGPHQEQAREMYSSLRKNLVENVFRQWKETGFAWE
QYNPETGKGQRTQHFTGWTSMVVKIMSMPDLPANKQIGHDEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	595	806	2.7e-34	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	310	808	2	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	2.00e-129	45	267	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	5.13e-07	528	756	358	561	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
215307	PLN02567	3.12e-05	598	819	328	554	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAR23808.1|GH63	0.0	1	822	1	822
BCS02288.1|GH63	0.0	1	822	1	822
BCS13967.1|GH63	0.0	1	822	1	822
CAL00956.1|GH63	0.0	1	822	1	822
BAK64066.1|GH63|3.2.1.106	0.0	1	822	1	822

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	2.90e-176	39	806	9	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	4.56e-141	45	807	37	776	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	8.46e-252	39	807	36	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	2.59e-176	24	806	22	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	2.92e-142	45	807	92	831	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	4.98e-135	47	807	94	831	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	1.49e-134	45	807	94	834	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.010421	0.989550	CS pos: 26-27. Pr: 0.8470

TMHMM  Annotations     

There is no transmembrane helices in EAW15728.1.