CAZyme Information: EAQ93857.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ93857.1
• CAZy Family: GT8
• CAZyme Description: DOMON domain-containing protein [Source:UniProtKB/TrEMBL;Acc:Q2HCG2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
220	CH408029|CGC1	23330.19	6.6265

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408029:6489816-6490659(+)

Full Sequence      

MHVFSNTISLLLPLLLLGGSQEAHASPAALDKRQTTGQYCNPESQICYLEYSWGPTVPVF
RIAVPDTASSNTPFDTLLQIVAPASLGWVGFSWGGGMTLNPLAVVWPNGQSATVSSRWST
GRTLPDLYPSATYHTVSASRNSTHWTVEAVCKGCSQWSGGGLSATGTNTFAWAVSKTAVA
QPANSASSFQIHNNVGMFSEGLEEGKVPAAVFEEYVKGAK

Enzyme Prediction     

No EC number prediction in EAQ93857.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA8	39	204	1.2e-47	0.945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	4.24e-57	39	208	1	176	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
187688	CDH_like_cytochrome	1.36e-51	38	199	1	165	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
187689	DOMON_DOH	6.86e-07	87	148	31	94	DOMON-like domain of copper-dependent monooxygenases and related proteins. This diverse family characterizes DOMON domains found in dopamine beta-hydroxylase (DBH), monooxygenase X (MOX), and various other proteins, some of which contain DOMON domains exclusively; the family is not restricted to eukaryotes. DBH is a membrane-bound enzyme that converts dopamine to L-norepinephrine, and plays a central role in the metabolism of catecholamine neurotransmitters. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO69821.1|AA8	3.01e-108	1	220	1	231
AEO59519.1|AA8	1.28e-103	2	220	7	225
VBB71295.1|AA8	7.57e-66	36	220	36	232
CDP22306.1|AA8	5.82e-61	36	220	36	224
VBB73733.1|AA8	2.00e-51	19	213	12	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JT6_A	3.16e-17	65	217	33	187	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]
4QI3_A	1.44e-13	39	163	8	141	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI3_B Chain B, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	8.48e-13	39	163	8	141	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]

Swiss-Prot Hits     

EAQ93857.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999745	CS pos: 25-26. Pr: 0.9686

TMHMM  Annotations     

There is no transmembrane helices in EAQ93857.1.