CAZyme Information: EAQ93729.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ93729.1
• CAZy Family: GT71
• CAZyme Description: Beta-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q2HCU0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
809		91783.67	4.7316

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408029:6111827-6114433(-)

Full Sequence      

MTPRVVIPLDKNWEFRQADKDDSKFLPVSQFPTNVHLDLQHHGLIPDAYIGKNELAVQWV
GEAQWTYRTTFAAQAVPEGAQAVIAFDGLDTFATVVLNGTTILEVDNMFLPERVNVTSVL
KEQNELVITFDSAYLRGCKRVEEHPNHKWGCWNGDVSRCRTEGTGWDWGPTLLTCGPWRP
VNLEIYESRLADLYTDTVVDKSLSRATVKLTAAVEGKAEKVRFDISLDGEQVATETADVS
SADTVTVSFLIDSPALWYPIRYGKQPLYDIKATLLASNEEVDTLSKRIGLRRAELIQRPL
QEQPGTSFFFEVNNIPIYCGGSDWIPADNFIPRISRQRYFDWIKLVAEGNQFMIRIWGGG
IYEEQAFYDACDELGILVWQDFMFGCGNYPAWPALLESIDREARENVKLLRHHPSIVIWA
GNNEDYQYQESEGLTYDYENKDAESWLKTDFPARYIYEKILAKACADLIPNTFYHPGSPW
GAGLNTRDATVGDIHQWNVWHGTQEKWQNFDKLVGRFVSEFGMEAFPSVKTIDSYLPLGK
DDPDRYPQSSTVDFHNKAEGHERRIALYLVENLRYAPDPLEQFVYSTQLMQAECLASAYR
LWKREWRGPGPGVLRRRARLANQRLLARHELEHRGLLPASQTGMWGSNLTLEDLTVDCVL
KAWDVVSGEETFSETVAPAKLLPENRSTEITALDVPVREKDVDEEARIVVAAYLVKDGKQ
IARYVNWPEPLKYVHLQKPKALKTQLTADFSAVEISADVPVKGVALECEDDEVKFDDNLV
DVVPGEVVSIGVRGASKDTKIETRYMGML

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	602	1.6e-82	0.550531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.24e-65	1	608	7	591	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	3.90e-13	645	733	6	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	8.05e-13	189	291	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236657	PRK10150	1.03e-07	4	424	10	417	beta-D-glucuronidase; Provisional
407625	Ig_mannosidase	4.97e-05	747	799	11	63	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO69937.1|GH2	0.0	1	809	1	851
AFJ59925.1|GH2|3.2.1.25	0.0	1	809	1	855
AEO53082.1|GH2	0.0	1	809	1	855
CAP59820.1|GH2	0.0	5	809	7	854
CDP22463.1|GH2	0.0	5	809	7	854

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	5.86e-110	1	603	21	610	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VQU_A	3.74e-95	6	593	8	598	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]
2VJX_A	3.74e-95	6	593	8	598	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	3.89e-95	6	593	10	600	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	3.97e-95	6	593	10	600	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	0.0	1	809	1	855	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|A1CGA8|MANBB_ASPCL	8.07e-245	8	807	8	844	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|A1D911|MANBB_NEOFI	2.29e-244	8	807	8	844	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
sp|Q5B7W2|MANBB_EMENI	9.77e-243	9	807	9	842	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
sp|Q4WAH4|MANBB_ASPFU	2.09e-242	8	807	8	844	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EAQ93729.1.