CAZyme Information: EAQ93565.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ93565.1
• CAZy Family: GT62
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:Q2HDA4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
269	CH408029|CGC24	29717.96	4.8940

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408029:5557954-5558922(+)

Full Sequence      

MVALNPLLLFGLAGFSGFNVDKLISFDGEAGQAIDTAEWNVITNVRYNNEVQDYTTSTDN
MHHSGNGTLLVIPLRSDSGQWTSGRIESTATYTPQDKKITRFQSHLRFGDSPQDKQQGIW
PAFWTLGGSSREGVPWPECGELDIMERKNGEPTGHGTPHCGPGDSPCGGLTKSVKLADNG
WHTWAIEVDRTDGDWKKQTIRWLLDDKEYNKVSGEDMEKEEIWKSVAHSPHYFILNVAVG
GNWPGPPNDKTADGLDNALEVKYIAVGSK

Enzyme Prediction     

EC	3.2.1.6:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	26	266	1.5e-51	0.9739130434782609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185691	GH16_Strep_laminarinase_like	4.33e-128	17	268	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	3.70e-45	26	266	5	234	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	1.11e-16	26	266	3	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
225182	BglS	4.17e-13	117	268	131	264	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185694	GH16_CCF	4.08e-09	119	266	129	328	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60389.1|GH16_3	1.33e-142	12	269	13	269
ATJ00809.1|GH16_3	1.78e-96	15	269	23	284
AEO64760.1|GH16_3	8.03e-93	15	268	24	284
AEO59417.1|GH16_3	3.24e-92	15	266	23	281
UPL03490.1|GH16_3	1.47e-84	17	266	25	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ATG_A	1.83e-40	26	266	11	237	endo-1,3-beta-glucanase from Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
3DGT_A	2.39e-40	16	268	7	275	The 1.5 A crystal structure of endo-1,3-beta-glucanase from Streptomyces sioyaensis [Streptomyces sioyaensis]
2HYK_A	8.28e-35	26	266	15	241	The crystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
7EO3_A	8.39e-33	15	266	7	277	Chain A, 1,3-beta-glucanase [Actinomycetia bacterium]
2VY0_A	7.62e-26	15	268	21	260	The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23903|E13B_NIACI	6.80e-17	22	266	424	678	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
sp|Q27082|CFGA_TACTR	3.47e-11	48	266	54	251	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.712673	0.287317

TMHMM  Annotations     

There is no transmembrane helices in EAQ93565.1.