CAZyme Information: EAQ93497.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ93497.1
• CAZy Family: GT59
• CAZyme Description: alpha-1,2-Mannosidase [Source:UniProtKB/TrEMBL;Acc:Q2HDH2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1102		120736.02	5.6106

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408029:5339348-5342711(-)

Full Sequence      

MDCRSLAADYGSRFSPGPAINDPRPPGVRLRRNWSHFLGCILFLVCCCCFGHWPAAAAMR
PDRVRELRRETVDMFYHGFDNYMNIAFPEDELRPVSCTPLSRDGKNPRNVELNDVLGNYS
LTLIDSLSTLAILASAPPEDGNTGSKALSDFQTGVAALVEQYGDGTPGPSGVGLRGRGFD
VDSKVQVFETVIRGLGGLLSAHLFAIGALPITGYEPRRPGDDLLKPRPVVWPNGFTYDGQ
LLRLAQDLGQRLLPAFYTKTGMPYPRVNLRHGIPFYTNSPLHGDGAAGTVDGPPEITETC
SAGAGSLVLEFTVLSRLTGDHRFEQLAKRAFWAVWYRKSQIGLIGAGVDAEQGNWIGSYA
VIGAGADSFFEYALKSHILLSGHDLPNRTVARPNQGGAWMDPNTIFPPLSDAENSPDSFL
EAWHHAHASIKRHLYSDRDHPHYENVNLWTGSLASNWVDSLGAYYSGLLVLAGEVDEAVE
TNLLYTAIWTRYAALPERWSMREKTVEGGLGWWPLRPEFIESTYHLYRATNDPWYLYVGE
MVQRDIARRCWTPCGWAGLQNVLDGEKSDRMESFFLGETAKYMYLLFDDRHPLNAFDGAY
VFTTEGHPLIIPTGVTEGRRQTARPNRKDLTIHHDEEFTNSCPPRPATTPLSGSVIAARD
DIYHAARMLDLHLLSTSPLTVDGGQMSGQHMARSNFTLYPWTLPAELLPSDGICARVNHP
AELILEFSSNAGQAAGGSAFNFMLGNQNLERLSVDRIRVTSLSGLKITMRLEESPEREWR
VNKINGVPLGRDESVIFDRSILGEISDPRFTLVRDPVMAKLQHLHQVDLLGNDTAETTNH
DAHQDDDEEPHVETLQDTEHSADALTDLGSLVKSLFSRITASLDIQLPTSLPSIGINIGT
GSASLPFNLVINTTAITPTGVGAAPLPDTGNTVPPRTPPFGPVPDAAFPWSTVYAAGDAC
GGATSNPNTTPLPDTAPRNHQILLLRRGGCSFSTKLANIPAFPPSPHALQLVIIVSDDDH
DSSPENPHPGLVRPLLDEVQRTPGGIPRRHPLAMVMVGGGEMVYQQLRAASRVGLVRRYF
VESQGVRVGNIIVDEGGDGGEW

Enzyme Prediction     

No EC number prediction in EAQ93497.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	74	610	1.9e-143	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.24e-133	74	611	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.54e-61	66	612	70	519	glycoside hydrolase family 47 protein; Provisional
239039	PA_PoS1_like	9.12e-05	935	1002	18	78	PA_PoS1_like: Protease-associated (PA) domain PoS1-like. This group includes various PA domain-containing proteins similar to Pleurotus ostreatus (Po)S1. PoSl, the main extracellular protease in P. ostreatus is a subtilisin-like serine protease belonging to the peptidase S8 family. Ca2+ and Mn2+ both stimulate the protease activity of (Po)S1. Ca2+ protects PoS1 from autolysis. PoS1 is a monomeric glycoprotein, which may play a role in the regulation of laccases in lignin formation. (Po)S1 participates in the degradation of POXA1b, and in the activation of POXA3, (POXA1b and POXA3 are laccase isoenzymes), but its effect may be indirect. The significance of the PA domain to PoS1 has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.
238300	PA	0.003	937	998	11	65	PA: Protease-associated (PA) domain. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following: i) various signal peptide peptidases including, hSPPL2a and 2b which catalyze the intramembrane proteolysis of tumor necrosis factor alpha, ii) various proteins containing a C3H2C3 RING finger including, Arabidopsis ReMembR-H2 protein and various E3 ubiquitin ligases such as human GRAIL (gene related to anergy in lymphocytes), iii) EDEM3 (ER-degradation-enhancing mannosidase-like 3 protein), iv) various plant vacuolar sorting receptors such as Pisum sativum BP-80, v) glutamate carboxypeptidase II (GCPII), vi) yeast aminopeptidase Y, vii) Vibrio metschnikovii VapT, a sodium dodecyl sulfate (SDS) resistant extracellular alkaline serine protease, viii) lactocepin (a cell envelope-associated protease from Lactobacillus paracasei subsp. paracasei NCDO 151), ix) various subtilisin-like proteases such as melon Cucumisin, and x) human TfR (transferrin receptor) 1 and 2.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO53259.1|GH47	0.0	1	1102	1	1113
AEO70189.1|GH47	0.0	59	1096	1	1022
VBB71678.1|GH47	0.0	33	1096	51	1138
CDP22661.1|GH47	0.0	33	1096	51	1151
CAP60020.1|GH47	0.0	33	1096	51	1116

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1FMI_A	1.06e-36	58	613	1	458	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1X9D_A	1.11e-36	54	613	75	536	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
1FO2_A	2.00e-36	61	613	4	458	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KIJ_A	7.75e-36	68	611	6	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	2.69e-35	68	613	6	453	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	2.06e-121	35	671	6	528	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q92611|EDEM1_HUMAN	7.26e-117	11	643	78	633	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|Q925U4|EDEM1_MOUSE	9.04e-116	56	617	114	587	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|P38888|MNL1_YEAST	1.92e-100	56	633	24	524	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	1.21e-93	65	609	35	476	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999916	0.000091

TMHMM  Annotations     

Start	End
34	56