CAZyme Information: EAQ93147.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ93147.1
• CAZy Family: GT35
• CAZyme Description: Alpha-glucosidase [Source:UniProtKB/TrEMBL;Acc:Q2HEH2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
941		103484.32	5.2902

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408029:4245460-4249492(-)

Full Sequence      

MEGGPPYREASSRSRRSDTSTCESTVTAMLTSGQTCPSDASPGDHDTFLNSWLTRQAVLF
TSGLTYAVRNHSRITLTGRLKNPWLILPAMALFSLTTLFLLTGLHMHATSGHYGLSGHVG
GPDQVAEHAPIFTLPASADVGKNVLPNIQDPEAVDPQTACPGYKASNVQDTESGFTADLD
LAGSACNVYGNDVENLALSVEFQSEDRIHVEIRPRYLSPENETWFLLPEELVPRPSIKKS
NSHRSNGLVVSWSNEPTFSFAVKRVETGDVLFSTEGKVLVYEDQFIEFASSLPENYNLYG
LGEVLHGFRLGNNFTNTRYFTAGHSEKLTYAANATDKTAQYLSYTHGVFLRNAHTQEIVL
QPSGITWRTLGGSVDLYFYSGPSAENVISSYQQSTTGLPAMQQYWTLGYHQCRWGYDSWA
ALQEVVDNFAKFEIPLETIWSDIDYMKQYRDFENNPVSFNYDEGAEFLTKLHAKDQHYIP
IVDSAIYAPNPENPSDAYAPYDRGIEAKAFVMNPDGSIYYGAVWPGYTAHPPFHLPGEPG
NLILQYPEGFELTNSSEAIPAASALREQEAASPTTVSPTSYHRTTPTPGVRDINWPPYVV
NNFHGDLAVHAISPNATHHGGYVQYDFHNLFGHQILNATYQALLQISPTKRPFIIGRSTF
AGSGKWAGHWGGDNEASWSHMAFSIPQALTFSLFGIPMFGVDTCGFGGNSALELCARWMQ
LSAFFPFYRNHNILGAIPQEPYLWADVARATRARHARALRPPSPTSTRSSRAPTPAATPS
CAPSPGSSPASPGSPPPTASSCLGRPCCVVPLQEPGMTTAQSRRRPWGLVVALDWEGLAK
GELYLDDGESLVPEAVTWVQFTATSTSISAEPQGDYVDTNALGNATVMGLAKGPVRVWMN
SHVLDLANWNYDEERATLSLHGLNDLFPQGAWAERWEINWE

Enzyme Prediction     

EC	3.2.1.20:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	377	756	1.3e-86	0.7423887587822015

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269888	GH31_MGAM_SI_GAA	9.63e-158	397	746	1	339	maltase-glucoamylase, sucrase-isomaltase, lysosomal acid alpha-glucosidase. This subgroup includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase. MGAM is one of the two enzymes responsible for catalyzing the last glucose-releasing step in starch digestion. SI is implicated in the digestion of dietary starch and major disaccharides such as sucrose and isomaltose, while GAA degrades glycogen in the lysosome, cleaving both alpha-1,4 and alpha-1,6 glucosidic linkages. MGAM and SI are anchored to small-intestinal brush-border epithelial cells. The absence of SI from the brush border membrane or its malfunction is associated with malabsorption disorders such as congenital sucrase-isomaltase deficiency (CSID). The domain architectures of MGAM and SI include two tandem GH31 catalytic domains, an N-terminal domain found near the membrane-bound end, and a C-terminal luminal domain. Both of the tandem GH31 domains of MGAM and SI are included in this family. The domain architecture of GAA includes an N-terminal TFF (trefoil factor family) domain in addition to the GH31 catalytic domain. Deficient GAA expression causes Pompe disease, an autosomal recessive genetic disorder also known as glycogen storage disease type II (GSDII).
395838	Glyco_hydro_31	1.26e-123	377	746	1	325	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269890	GH31_glucosidase_II_MalA	2.02e-84	397	742	1	304	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
224418	YicI	5.51e-72	160	746	27	553	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269886	GH31_MGAM-like	1.99e-65	397	746	1	240	maltase-glucoamylase (MGAM)-like. This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II. MGAM is one of the two enzymes responsible for catalyzing the last glucose-releasing step in starch digestion. SI is implicated in the digestion of dietary starch and major disaccharides such as sucrose and isomaltose, while GAA degrades glycogen in the lysosome, cleaving both alpha-1,4 and alpha-1,6 glucosidic linkages. MGAM and SI are anchored to small-intestinal brush-border epithelial cells. The absence of SI from the brush border membrane or its malfunction is associated with malabsorption disorders such as congenital sucrase-isomaltase deficiency (CSID). The domain architectures of MGAM and SI include two tandem GH31 catalytic domains, an N-terminal domain found near the membrane-bound end and a C-terminal luminal domain. Both of the tandem GH31 domains of MGAM and SI are included in this family. The domain architecture of GAA includes an N-terminal TFF (trefoil factor family) domain in addition to the GH31 catalytic domain. Deficient GAA expression causes Pompe disease, an autosomal recessive genetic disorder also known as glycogen storage disease type II (GSDII). GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. Alpha-glucosidase II is a GH31 enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This family also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source. The MGAM-like family corresponds to subgroup 1 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO53630.1|GH31	0.0	90	941	1	993
QED93305.1|GH31	0.0	58	941	165	1195
AEO70510.1|GH31	0.0	64	941	171	1195
CDP23003.1|GH31	0.0	56	941	68	1109
VBB72076.1|GH31	0.0	56	941	166	1206

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W37_A	1.30e-105	162	752	44	647	Sugar beet alpha-glucosidase with acarbose [Beta vulgaris],3W38_A Sugar beet alpha-glucosidase [Beta vulgaris],3WEL_A Sugar beet alpha-glucosidase with acarviosyl-maltotriose [Beta vulgaris],3WEM_A Sugar beet alpha-glucosidase with acarviosyl-maltotetraose [Beta vulgaris],3WEN_A Sugar beet alpha-glucosidase with acarviosyl-maltopentaose [Beta vulgaris],3WEO_A Sugar beet alpha-glucosidase with acarviosyl-maltohexaose [Beta vulgaris]
5NN3_A	1.06e-101	161	920	54	857	Crystal structure of human lysosomal acid-alpha-glucosidase, GAA [Homo sapiens],5NN5_A Crystal structure of human lysosomal acid-alpha-glucosidase, GAA, in complex with 1-deoxynojirimycin [Homo sapiens],5NN6_A Crystal structure of human lysosomal acid-alpha-glucosidase, GAA, in complex with N-hydroxyethyl-1-deoxynojirimycin [Homo sapiens],5NN8_A Crystal structure of human lysosomal acid-alpha-glucosidase, GAA, in complex with acarbose [Homo sapiens]
5NN4_A	1.06e-101	161	920	54	857	Crystal structure of human lysosomal acid-alpha-glucosidase, GAA, in complex with N-acetyl-cysteine [Homo sapiens]
5KZW_A	2.95e-101	161	920	56	859	Crystal structure of human GAA [Homo sapiens],5KZX_A Crystal structure of human GAA [Homo sapiens]
2QLY_A	3.09e-91	167	882	57	811	Crystral Structure of the N-terminal Subunit of Human Maltase-Glucoamylase [Homo sapiens],2QMJ_A Crystral Structure of the N-terminal Subunit of Human Maltase-Glucoamylase in Complex with Acarbose [Homo sapiens],3CTT_A Crystal complex of N-terminal Human Maltase-Glucoamylase with Casuarine [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12558|AGLU_ASPOR	1.37e-279	132	940	37	985	Alpha-glucosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=agdA PE=2 SV=1
sp|P56526|AGLU_ASPNG	1.60e-275	126	940	29	985	Alpha-glucosidase OS=Aspergillus niger OX=5061 GN=aglA PE=1 SV=1
sp|O74254|AMYG_CANAL	1.63e-202	133	940	34	946	Glucoamylase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GAM1 PE=1 SV=3
sp|P22861|AMYG_SCHOC	4.74e-195	133	940	44	958	Glucoamylase 1 OS=Schwanniomyces occidentalis OX=27300 GN=GAM1 PE=1 SV=1
sp|Q9URX4|YFZB_SCHPO	3.33e-173	131	940	50	991	Uncharacterized family 31 glucosidase C1039.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1039.11c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000043

TMHMM  Annotations     

Start	End
83	105