CAZyme Information: EAQ92824.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ92824.1
• CAZy Family: GT25
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:Q2HFE5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
887		97467.25	5.1712

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408029:3287902-3290955(-)

Full Sequence      

MAALAPTDRVDLGQDIDLNASPAGSIDTNTTVNTTPDTEFSPPESPIQRSGPPKNARTLA
KTKLASLALEEKVSLLAAADFWRTKAIPSKNIPAVKTSDGPNGARGGIFVGGTKAALFPC
GISLAATWNKDILYQVGQHLADEVRARSADVLLAPTVCLHRHPLGGRNFESFSEDPLLCG
KLSAQYIKGLQEKGIAATIKHFVGNEQETHRLTINSIIAERPLRELYLRPFEIAIREAKP
WAVMSSYNLVNGLHADMNTHVLRDILRGEWGFDGTVMSDWGGVNSTVESIKAGCDVEFPY
SDKWRFEKVIDALKEGRIEEADIDRAAENVLTLVERTKGSDLTPEAAEREDNREETRKLI
HELGVQGLTLLKNEGSILPINPTTAKVAVIGPNANRAIAGGGGSASLNPYYNTLPLDSIR
KVAQQPVTFSQGCHIHKWLPVASPYCSDKTGKQGVSIEWFKGDKFEGQPTIVQRRTNTDL
FLWDSAPLSEIGPHWSAIVTSYLTPPSTGKHTISFMSVGPGKLYINGKLALDLWNWTEEG
EAMFDGSIDYLVDVEMQAGRPVELRVEITNELRPLAKQKQFNMTHKYGGCRIGFKAEDQV
DYLQEAVDAAKAADVAVVVVGLDAEWESEGYDRKNMDLPSDGSQDRLVEAVLKANPNTVV
VNQSGSPVTMPWADRVPAIIQAWYQGQEAGNALADVLFGLKNPSGKLPCTFPRRLEDTPA
YNNWPGENLDVIYGEGMYMGYRHYDRIGLAPLFPFGHGLSYTSFEYGRPSLSSRVLTEDG
TIDLVVGVSNVGAVRGLETVQVYVRDEKSRLPRPEKELAAFEKVELEAGETKHLRIPIDK
YAVGYFDTSIGRWIAEEGTFRVLVAASAADVKYDVSFEVKESFTWLF

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	86	298	3.4e-69	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.50e-83	118	878	120	763	beta-glucosidase BglX.
224389	BglX	5.68e-77	80	405	48	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.17e-52	368	741	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.53e-46	92	333	66	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.94e-46	53	839	50	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO53892.1|GH3	0.0	1	887	1	884
AEO66128.1|GH3	0.0	1	887	1	888
VBB72333.1|GH3	0.0	17	887	22	908
CDP23238.1|GH3	0.0	17	873	22	896
CAP69216.1|GH3	0.0	17	873	22	896

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	8.30e-185	64	885	10	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.97e-180	64	885	10	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.27e-145	61	882	6	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.48e-121	67	871	12	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.44e-113	64	881	8	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	6.50e-229	64	880	15	841	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1CA51|BGLI_ASPCL	3.48e-206	64	886	10	836	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	2.45e-203	64	886	10	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	9.76e-203	64	886	10	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.22e-200	64	886	10	836	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000002

TMHMM  Annotations     

There is no transmembrane helices in EAQ92824.1.