CAZyme Information: EAQ92143.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ92143.1
• CAZy Family: GT17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1406		157114.46	5.5869

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408029:1152230-1157216(+)

Full Sequence      

MTWPSELRLQGSARASDEGGLEAPRLLAGLFSHAPRETAASENATVYFSILDRIAKGHFV
EAKTDKALYEKFIQVLRDDGHMDREALSTFKLALSMRTAAPRVEAHYQYYATAVEPSLSE
DQDGCGQWFYVDGKQYCTPAIGDVHRAVTENNQGRPLPFDRKFGTGARDVILYADITASD
FGTYHETAMKIAQSGEGAYRVRYRRSPAHPSEALSVNGYGVELTLKRTDYIVIDDRNTGA
AKASGNEAQKPIGSSEVVLDDEEVTDIKPLEKSELASLGMKAASFIMQSESPFETLLKLT
QDFPKYSTSLGAHNVSAEFRAEHEDNRKVLVPEGMNVLWMNGVQLIERQIQPFGLVDLLT
RERRLINGVLDLGLTGQQAISLLGHTDVAHAKSGGEEPRRFDWRDEIEDGRVIVWLNNLE
KDKRYQDFAPSIWALMQHFGQGLPQYSRRLVPIRFGLVPLTPTGEAIEQAKIVYYLLETH
GLSAAVSYLEKSLEHQKTAKPDESIFNEAIKDRPLRPESTVLSFNDIFTSESHEKQIHLA
KHWVERLRAGGEVPSVFMDGFAIPRDENWLRAMNQKLMGDLQALQQAAYFGQVNDGTWIP
GRFLENAITRRNTLIFPEDAKDLKVLNVNKVYTEHHNVFDKVPVIEADDQSTKEDWAALT
VIADLDSLEGQKLLLFALQFRSEHSGVRVDIVHNPKDVARPASQLTQRIKARESDLAAAI
QLLDLETILESGKAETDAAYDTALASFIADFSLKEGDNALILNGRVAGPIVSAEEFKKED
FVQFLEAERASRILPVYKAVEDLGLGDKILGPLDAAKLTSVTALSGISDLPQGIFDQASS
ARTAAFNELKGAHTSFQVGDSSTATIFFVAVINPASEVGQKWAAVLKVLSELEGVHLQVF
LNPADELGELPIKRFYRYVLESSPSFDDHGKVSVDDLDNLRIKDIKAKRGTDHIEAVYQL
ENILIEGHSRELPAGQPPRGVQLVLGTEKDSQFADTIIMANLGFFQFKANPGVYNLRLKE
GRSSDIFTMESLGAEGWTPVPGDDSDEIALMDFQGTTLYPRLRRKPGMEEEDVLEEANTD
TATGAAGAAMDFVSKGLKFAEGLLGRGKPTAETTNSLATTQHAEINIFSVASGHLYERML
NIMMVSVMRHTNHTVKFWFIEQFLSPSFKDFIPHLAAEYNFSYEMVTYKWPHWLRQQKEK
QREIWGYKILFLDVLFPLSLDKVIFVDADQIVRTDMHELATLDLEGAPYGFTPMCDSRTE
MEGFRFWKTGYWANYLKGHPYHISALYAVDLRRFRELAAGDRLRQQYHALSADPNSLANL
DQDLPNHMQFQIPIHSLPQSGCGARRGAATTLSRRPAPSTCAITRRPRSPSWTGRGGRCS
SGPSTTRRSLRWRGGEEEQRGQVERL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1125	1340	1.1e-111	0.8669354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	2.76e-167	1125	1339	1	215	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	2.36e-155	1125	1339	1	215	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	2.66e-75	401	615	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408202	Thioredoxin_15	7.27e-71	627	823	1	204	Thioredoxin-like domain. This is the fourth TRXL(thioredoxin-like) domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	6.23e-66	966	1075	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60260.1|GT24	0.0	36	1339	34	1395
AEO67685.1|GT24	0.0	37	1339	51	1412
CDP29610.1|GT24	0.0	4	1339	21	1406
CAP49306.1|GT24	0.0	4	1339	21	1406
CAD60785.1|GT24	0.0	4	1339	21	1406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	37	1339	30	1394	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	37	1339	30	1394	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	0.0	37	1339	30	1394	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	37	1339	30	1160	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	0.0	37	1334	23	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	3.41e-207	31	1339	35	1371	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	3.86e-180	90	1339	118	1470	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q09332|UGGG_DROME	9.14e-175	37	1338	49	1453	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9JLA3|UGGG1_RAT	3.61e-174	64	1339	94	1470	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	3.60e-173	91	1339	119	1470	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EAQ92143.1.