CAZyme Information: EAQ91514.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ91514.1
• CAZy Family: GH72|CBM43
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
901		99551.51	9.4529

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408030:4237859-4241947(+)

Full Sequence      

MRSPIIVLSVIALWAQAAKSAYDGRLCNNGSYDTPGTSLTCKTPARCLVARPLEGLTRRQ
TSRTLGTRIAKGSPASRWSSDPGSVHSYPHVKFSDPVLPVPLSNISALTLSAQWAMGPGS
TSRSVPGIDAPGLARLDASANAAFDIFADRIPQNSLRETEAETEIMVWLGRVGYAQPLGY
EGTESYRAKLTVGHVDFTLYLGKNQRGTSVFTWAAQSNETSFAADISPLLQYLWRNGLVS
PGSNMGLIGWGTEGYHAEGNVTFSSARRTIGYLLRMATLHPSRPGTPGSQQSNPSSGGTR
DPFRDPSQASSPATDSRTSLILTNSQTPVTRLGEINEKAGHASGSDMDAAVAASNPEKGG
STAAAATASPKKSRNPFKRSYGAFRRTYCPIEEPGLVFPTGPTDKEKLEYISTNRIPLYI
FGVFSFLTLSAGMWLFAVSSPIFSWYGVFVGFLNIYLIISYFVGIIGRDWDYAAHQALVA
QHPITDTTAPTVDVYLPCCSEPLEILQNTYNHILRLDWPASKLQVHVLDDGDQPAVRALA
ARYGFHYLVRDDRPRLRKAGNLRWAFSRTAGEFFAIFDADFCPRPDFLRELVVEHLADDK
TAIVQSPQYFRVTDDQTWVEQGAGATQELFYRVVQVNRNRWGASICVGSNAVYRRAALEE
VGGTAEIGFSEDVHTGFGAVDRGWKVKYVPLCLATGICPNTPRSFFSQQMRWARGSTTLL
TTKHFWVSKLTVMQKICYLCGELGVHTRGKRSADVPGLLYYSAVSLGIFISPIPGTLLLF
FRPEWFKYYNLAFAIPSIIYGSLLFRFWAKAKYGFNVQHIMVVQSYAYLTAIKDRLFGIE
LLWAASGDKKAHKSNKYRNMRILCWLWTIVSVGGVIAAVTYRLLTGFPWYHTIPLWGTWG
F

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	494	662	1.9e-25	0.9882352941176471
GH12	138	264	1.6e-21	0.7948717948717948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	2.01e-103	490	720	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	3.81e-43	427	808	5	361	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	2.30e-39	483	739	253	512	cellulose synthase catalytic subunit; Provisional
133045	CESA_like	8.35e-34	494	672	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133059	CESA_CaSu_A2	1.57e-33	490	716	1	232	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO69079.1|GH12|GT2	0.0	1	895	1	870
AGY80099.1|GH12|GT2	0.0	22	895	1	863
VBB86309.1|GT2	0.0	275	895	4	630
CAP68353.1|GT2	0.0	275	895	4	630
CDP31824.1|GT2	0.0	275	895	4	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.65e-33	490	810	273	591	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	1.41e-29	483	739	121	399	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.77e-29	483	739	133	411	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.77e-29	483	739	134	412	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
1OA3_A	2.10e-11	77	270	49	217	Chain A, ENDO-BETA-1-4-GLUCANASE [Trichoderma citrinoviride],1OA3_B Chain B, ENDO-BETA-1-4-GLUCANASE [Trichoderma citrinoviride],1OA3_C Chain C, ENDO-BETA-1-4-GLUCANASE [Trichoderma citrinoviride],1OA3_D Chain D, ENDO-BETA-1-4-GLUCANASE [Trichoderma citrinoviride]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P58932|BCSA_XANAC	7.51e-39	490	739	153	405	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
sp|P0CW87|ACSA1_KOMXY	5.20e-36	475	810	135	467	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
sp|Q93IN2|BCSA_SALTY	1.76e-35	490	877	273	687	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
sp|O82859|BCSA2_KOMSB	2.62e-35	490	739	149	403	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|P19449|BCSA1_KOMXY	3.44e-35	490	739	149	401	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000264	0.999694	CS pos: 17-18. Pr: 0.9702

TMHMM  Annotations     

Start	End
416	438
442	464
758	780
790	809
862	884