CAZyme Information: EAQ90467.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ90467.1
• CAZy Family: GH62
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:Q2HBK2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430	CH408030|CGC21	47326.04	4.9373

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408030:864668-866082(+)

Full Sequence      

MATPEVEKNAIKVMIVGDSISHGREGDWTWRYRIWEWFSQEDIDVRFVGPYKGTIPPDEP
HPPYPPRLQDEPPQLPAPLRTDGGYAAGVHPDFLSNCHHFAASGQQAYVAKDLVAEQVAA
YQPDLCLVQLGFNDLGWRMCGPAVTLASIGQLLEEARSAKPDLKFAVANVPQRTDIPGRE
DLPRDTDLYNDMLAQAIHSWDTVKSPVALVCFCENYSCGGSNSDAAYDGLHPNALGEYQL
AQAFSRTLVSDFSIGRSPLVIPEPVPPRPLPTPARFGAASTPGGIVVSWEHVYGALGYDF
QHRLVDDDEWATTHLDCNRYYWPPLWDGQVVECRVRTSGGDNFKSPWSNVSAAVARPETP
PPPSNMVTRATATGFTITWDPPPPSSYTGEIDRYGLIYFDCDQPGAFPGIAGVRGKRAEA
SRRRTLRGCG

Enzyme Prediction     

No EC number prediction in EAQ90467.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	11	248	5.2e-42	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	4.18e-44	96	248	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.86e-09	100	240	39	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	5.96e-09	98	244	39	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	9.84e-07	116	239	42	158	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
394996	fn3	3.98e-05	361	406	1	45	Fibronectin type III domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ09962.1|CE0	6.47e-125	8	415	509	914
SCG40251.1|CE0	4.05e-115	5	418	330	737
CAK39824.1|CE0	1.09e-80	7	269	135	388
BAE63679.1|CE0	2.41e-75	11	275	57	317
BAE60780.1|CE0	6.07e-61	62	290	18	243

PDB Hits     

EAQ90467.1 has no PDB hit.

Swiss-Prot Hits     

EAQ90467.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EAQ90467.1.