CAZyme Information: EAQ90228.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ90228.1
• CAZy Family: GH5
• CAZyme Description: Sialidase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:Q2HC91]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	CH408030|CGC4	38745.06	4.1062

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408030:83891-84958(+)

Full Sequence      

MEIGLRRLECAENELFIHETPSTYPRLCRLADGSILAGFTAFEPDGQRVLTIKRSTDDAA
TFEAHGEVARSSGDCDNLFLLELPASADSNESNPPTILAAFRNHDTDPDGTHTYFRITVC
QSTDGGRTWTFLSQAAEKPAPFGLWEPFLRMAGTDDDDEIHMYFSQEMDTDDQDTMLVRS
TDGGATWTATQRVTGEGEALRDGMVGVAAMTSCDKELEALILVMETTRLGTFSIEAVLSF
DNAETFGSRQPVYVPKEGRNAGAPQITAFADGSVAVVFMTDEDEDDDPTWPSGATIKAIF
GMLKSDGSLSWGEPQIISERLSSWPGIMHMRDASAMAVYESTSIIKSRLLSSVAE

Enzyme Prediction     

No EC number prediction in EAQ90228.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	22	286	1.1e-60	0.8697068403908795

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	4.99e-07	28	208	151	321	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.39e-06	99	280	162	324	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	5.23e-06	96	315	26	241	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO58437.1|GH93	1.55e-161	1	350	1	350
AEO68654.1|GH93	3.42e-145	1	352	1	368
BCR99274.1|GH93	3.88e-102	23	340	60	364
BCS11580.1|GH93	3.88e-102	23	340	60	364
BCS24955.1|GH93	1.06e-101	12	348	41	360

PDB Hits     

EAQ90228.1 has no PDB hit.

Swiss-Prot Hits     

EAQ90228.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EAQ90228.1.