CAZyme Information: EAQ89529.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ89529.1
• CAZy Family: PL1
• CAZyme Description: LysM domain-containing protein [Source:UniProtKB/TrEMBL;Acc:Q2H5B7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403		43942.99	7.7392

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408031:2612529-2613824(-)

Full Sequence      

MTQYDNNNYSQGGYQGGGYPQGNPPPYNQNQGYNQNQGYGNQGQGYGNQGQGYNQGQGEA
ASYYAGAPQHQQQQGYGQQGYGQNQQHHQRDSNNGPQEDGPAGERGMLGALGGGIAGAVG
GNKIGGKATGHSKTSTVIGALAGAFAGHKLQDGVSDWKDNRDEEKEKKKKEEEEEKRREE
ERKRREADEKRRREEEKKNEHHRPQHHEGRNHSPPRHEHHNQSRDRGVSYAGNFSSSARD
TRLDAHGEYMLHASCKRLDGSYQSTSISLNKIIENDRGSFRWSSGGRSSGGGGPSSYTVQ
PGDTLRNIAAKYNTSFEEIARINNIPNPDLIHPGTNLQIPGSGGNNNNSGGGGNFGASAR
DVRLADGGRRLEGELLRDGKWVGSSIILDERLSNNNGTLQYIE

Enzyme Prediction     

No EC number prediction in EAQ89529.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400991	CVNH	2.71e-20	234	400	1	101	CVNH domain. CyanoVirin-N Homology domains are found in the sugar-binding antiviral protein cyanovirin-N (CVN) as well as filamentous ascomycetes and in the fern Ceratopteris richardii.
212030	LysM	2.68e-15	297	339	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
396179	LysM	3.93e-13	297	340	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
197609	LysM	1.33e-12	297	339	2	44	Lysin motif.
224306	LysM	8.59e-06	297	340	69	111	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO54574.1|CBM50	1.51e-105	56	403	17	341
CEF78377.1|CBM50	2.72e-91	56	402	61	403
CZS81672.1|CBM50	2.96e-89	58	402	58	398
QPC70934.1|CBM50	7.22e-85	55	402	59	401
QPC59613.1|CBM50	7.89e-85	55	402	61	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2L9Y_A	1.51e-40	229	399	2	164	Solution structure of the MoCVNH-LysM module from the rice blast fungus Magnaporthe oryzae protein (MGG_03307) [Pyricularia oryzae 70-15]
5C8O_A	2.26e-38	229	399	5	151	Crystal structure of MoCVNH3 variant (Mo0v) [Pyricularia oryzae],5C8P_A Crystal structure of MoCVNH3 variant (Mo0v) in complex with (N-GlcNAc)3 [Pyricularia oryzae],5C8Q_B Crystal structure of MoCVNH3 variant (Mo0v) in complex with (N-GlcNAc)4 [Pyricularia oryzae]
4UZ2_A	4.92e-06	293	340	1	47	Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RVY3|Y888_DEIRA	5.94e-07	293	341	202	253	Uncharacterized protein DR_0888 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) OX=243230 GN=DR_0888 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EAQ89529.1.