CAZyme Information: EAQ89510.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ89510.1
• CAZy Family: GH43
• CAZyme Description: Amb_all domain-containing protein [Source:UniProtKB/TrEMBL;Acc:Q2H5D6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317		32760.41	7.1155

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408031:2561885-2563126(+)

Full Sequence      

MKFLFTATIATLASFVAATPTQVVKRASPEDKCDIGYASINGGTTGGAGGTTTTVSNLSD
LTAAVKGDAKKIVLVSGSISGTGSIKVGANTSLLGKSGASITGVGLTIKEANNVIIRNLK
LSKVKGGDCVAVQEASNIWLDHLDISGDLSADKDYYDGLLDITHAGDYVTVSNSHFHDHW
KASLVGHSDSNAAEDTGKLRVTYANNKWTNINSRTPSIRFGTGHIYNNYFDTITTSGVNT
RMGAIVFVESSTFVNAKRAITSIDSDVDGKAAVKDVDLGGSTNDAPAGSLSVPYSYSVVG
SANAKSSNANSGATLSF

Enzyme Prediction     

EC	4.2.2.2:30

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	75	253	6.4e-82	0.988950276243094

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	4.82e-59	75	257	2	190	Amb_all domain.
226384	PelB	6.52e-47	3	307	9	334	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.41e-35	85	253	30	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO58739.1|PL1_7	3.40e-150	1	317	1	326
CAW70624.1|PL1_7	1.79e-109	1	305	1	315
CBC41481.1|PL1_7	1.79e-109	1	305	1	315
QPC63510.1|PL1_7	1.79e-109	1	305	1	315
CEF83500.1|PL1_7	1.79e-109	1	305	1	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	7.71e-38	36	255	6	248	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	2.22e-32	31	230	5	246	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
1OOC_A	4.43e-27	22	230	2	257	Chain A, Pectate lyase A [Dickeya chrysanthemi],1OOC_B Chain B, Pectate lyase A [Dickeya chrysanthemi],1PE9_A Chain A, Pectate lyase A [Dickeya chrysanthemi],1PE9_B Chain B, Pectate lyase A [Dickeya chrysanthemi]
1JRG_A	8.47e-27	22	230	2	257	Chain A, Pectate lyase [Dickeya chrysanthemi],1JRG_B Chain B, Pectate lyase [Dickeya chrysanthemi],1JTA_A Chain A, pectate lyase A [Dickeya chrysanthemi]
2QXZ_A	3.69e-26	82	265	65	258	Chain A, pectate lyase II [Xanthomonas campestris pv. campestris],2QXZ_B Chain B, pectate lyase II [Xanthomonas campestris pv. campestris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NBC2|PLYB_ASPFN	1.68e-99	9	294	6	303	Probable pectate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyB PE=3 SV=1
sp|Q2TZY0|PLYB_ASPOR	1.68e-99	9	294	6	303	Probable pectate lyase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyB PE=3 SV=1
sp|O59939|PLYB_COLGL	1.04e-96	20	317	32	331	Pectate lyase B OS=Colletotrichum gloeosporioides OX=474922 GN=PLB PE=3 SV=1
sp|A1CYB8|PLYA_NEOFI	1.52e-96	1	317	1	321	Probable pectate lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyA PE=3 SV=1
sp|Q4WIT0|PLYA_ASPFU	8.65e-96	1	317	1	321	Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999764	CS pos: 26-27. Pr: 0.9709

TMHMM  Annotations     

There is no transmembrane helices in EAQ89510.1.