CAZyme Information: EAQ89265.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ89265.1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
924		102068.61	5.9352

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408031:1806756-1809530(+)

Full Sequence      

MARATRLLAFMGILRILAAAARANAASSVKISWVGDSPAQNLGTTFGLPWPQGKYQPDKV
DFDVADGQTPLESWVTGYWRDGSIKWSAHAIPKTDDVTDGYTIRAMPTVKGKPKGKRQTT
SLSVEDRESEVTVNTGKLTISFPKEGRYIVSSIKTAGGKTVGKNGRLVLHSQNNIPDTAD
DRTDKAIDRSNFESNIEEVTVSEGNSVRALVTVRGKHTTTEGSDHEDWLPFVVRFYLYAG
SEAIRLVHSITFDGQHDKDFISGLGIRFQVPLEGEELYNRHIRLAGTDGGFLNEAVKGIT
GLRRDPGEAVRTAQVQGKALPDEATWDTRVTTRLHWIPAWNDYSLSQLSPDGFTLKKRTK
PGQSWVNILGGTRSGGLAYLGGATRGGLAVALRDFWKRYPTGLDIANAGSDEGQITLWLY
SPDAAPLDLRGYHDGLGLDTYEKQLDALEITYEDYEKNFDTPYGISRTSEVFLYAFESTP
SSDTLAELNANAQEPPVLVAAPKYIKETKALGSYWGLPDTSTPAKAKIESNLDFLVKHYQ
KEVEARRWYGFLDYGDVMHTYDPSRHQWRYDIGGYAWDNSELSPDLFLWQYFLRTGRADV
YRLAEAMTRHTGEVDVYHLGDWKGLGTRHGVTHWADSAKQARISQPQYRKYFFYLSGGDE
RTGELLAHALDADQTYGLLDPVRKVRTDGWTPSPGAPVTFGLGTDWAALAAGWLLEWERR
GPRWQEARQKLTNTAAGIARLRNGFVTGSASYRIDQNGTLQPPPTDPDNQGVVAISHLNA
VFGMPEVVSELLEYWGGGDDGDGDGAPRGFREAWLDYAYYYLATADEQRARYGASFSGVS
LRQAHSRLSAYYAAVQGNATVAARAWADFGRSDGLKDTQEFAAVRVGGSAVVHPVEEAAW
LSTNDFAQYGLASIQNLAYVGDSI

Enzyme Prediction     

EC	4.2.2.24:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL26	30	923	0	0.9965197215777262

CDD Domains     

EAQ89265.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO54588.1|PL26	0.0	1	924	1	951
QMW47023.1|PL26	0.0	28	924	29	921
QMW34948.1|PL26	0.0	28	924	29	921
QRD91285.1|PL26	0.0	28	924	29	921
UDD63997.1|PL26	0.0	28	924	29	921

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XQ3_A	0.0	27	924	6	901	Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQ3_B	0.0	27	924	6	901	Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQG_A	0.0	27	924	6	901	Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQJ_A Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum]
5XQO_A	0.0	27	924	6	901	Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum],5XQO_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31530|YETA_BACSU	7.33e-157	30	924	3	846	Uncharacterized protein YetA OS=Bacillus subtilis (strain 168) OX=224308 GN=yetA PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000216	0.999775	CS pos: 25-26. Pr: 0.9142

TMHMM  Annotations     

There is no transmembrane helices in EAQ89265.1.