CAZyme Information: EAQ89181.1

Basic Information

• Species: Chaetomium globosum
• Lineage: Ascomycota; Sordariomycetes; ; Chaetomiaceae; Chaetomium; Chaetomium globosum
• CAZyme ID: EAQ89181.1
• CAZy Family: GH38
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407	CH408031|CGC20	44439.37	4.6006

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglobosumCBS148.51	11232	306901	184	11048

• Gene Location: location=CH408031:1572122-1573621(-)

Full Sequence      

MRLSTFLARFSYVWATQGLLVQSVQGHHQDARPVSESSTDDGSGASQIPARSGLLHPRQG
FDARAAAKAAIDALNTKFYSSTEAIWSPGAPWWLSGVALTSVIDYMRKTGSRDYLAQVEH
MIHVQRTQWSNTGGDFRGPSTDDTGWWALAMIRMYDLTGNDSYLDISVEDEAYMYDCWTL
SPCGGGMFVDIATKTYKNAIANELYIKLAASLHNRIANGIDYLARAETAWTWFQASGMIK
NDSLINDGLTASSDGVCYNNNLPVWTYNQGVIIGALVELYQATASEAYLTNAYTIADAVL
SSQTTPQLTRDGILTEGACEPDEANGCNHDQQVFKGVFAYNLDELSNAIPDGSANPYRSY
LQQNAQSAYTHARAEATDLYDVSWVGPFRNSTIGKQASAVGLLVAAI

Enzyme Prediction     

No EC number prediction in EAQ89181.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	67	394	1.3e-80	0.8603351955307262

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.23e-39	92	368	35	313	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.63e-17	92	405	46	345	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO57624.1|GH76	1.93e-190	41	407	24	399
AEO69376.1|GH76	1.46e-144	1	407	1	463
EAA27974.2|GH76	5.73e-117	74	405	1	329
ADI12151.1|GH76	2.22e-112	63	407	30	366
QKG20016.1|GH76	2.41e-107	67	403	29	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	6.36e-23	92	384	46	314	Chain A, Lin0763 protein [Listeria innocua]
6SHD_A	2.57e-17	92	405	88	385	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
4V1S_A	3.15e-08	142	292	143	290	Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4V1R_A	2.31e-07	142	292	143	290	Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1R_B Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4MU9_A	1.17e-06	138	292	114	261	Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q05031|DFG5_YEAST	3.54e-15	79	350	57	333	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.915126	0.084890

TMHMM  Annotations     

There is no transmembrane helices in EAQ89181.1.